HélèneRichard'ssurvivalhopeswerealreadyminimalwhensheendedhergruellingchemotherapy.
Toforceittothinkthatitfeelssomethingthatitshouldbefeelingwhenitseessomething?
"Atthemoment,themindcannotbedeceivedtoowell"
We'rewellplacedintheWorldqualifyinggroup.
Nothingveryimpressive,comparedtoglobaltransactionsinrealcurrencyorfinancialproducts.
InQuebec,therearepalliativecarebedsfor11,700inhabitants.
Peoplesay:spiritualculture,consumerculture.
Theearthisindanger.
However,inthisvitalarea,muchremainstobedone.
TrakhtenbergwasthepresenterofmanyprogramsbeforeHali-Galitimes.
Accordingtoofficialstatisticsoftheauthorities,thenumberofsuchcrimesinRussiaonthewholedropped7%ascomparedtoJanuary-October2011,amountingto22,900,whilethenumberofcasesoftheftandextortionofweapons,ammunition,explosivesubstancesandexplosivedevicesdroppedby7.8%.
I'mafraidthatpatientsasktodiebecausetheydon'treceiveadequatecare.
Theserestrictionsarenotwithoutconsequence.
ItispreciselythislargegapinQuebechealthcarewhichhasmadeanumberofpalliativecarephysiciansfeartheadoptionofalawoneuthanasiaandassistedsuicide.
Alongwitha93-year-oldmanwhoissavouringhislastmeetingwithhisfamily,sittingfirmlywedgedinhispillowswhiletoastsaredrunkinhishonour,a36-year-youngmanisdyingtragically,surroundedbyhisparents,hiswifeandhistwoyoungchildren,afterhavingtriedeverythingtosurvive.
Inaddition,fivemillionnewvotersin2012donothavesuchidentification.
WhiletheEgyptianPresidentwasspeakingyesterdayeveningontelevision,demonstrationsareplannedforthisafternoon.
Rightnow,nobodyisabletopredictwhetherthiswavewillturnintotheninthwaveoritisdestinedtofizzleoutearly.
-Manyofmyworksarehits,withclearlyreflectedrelevanceandacuity.
InLigue1,wouldnotwinningthetitle,likelastseason,beabigfailure?
Nowadays,peoplearejudgedbyappearance,nottheirinnerqualities.
Youwon'tbeabletovisitallofthemononetrip
Thisstudyalsoshowed,withafollow-upafter12years,thatitisbetween30and40%morelikelyformetastasestooccurintheabsenceofscreening.
Onthisday,someemployeesoftheWalmartcorporation,whichemploys2.2millionpeoplearoundtheworld,lefttheirworkplacesandpicketedtogetherwiththeunionsandleft-wingactivistsfromthecorporationstoresthatsellproductstopeopleonlow-to-mediumincomes.
MayoroftheboroughofRivière-des-Prairies,totheEastoftheisland,sheprotestedin2010againstthesaleofmunicipallandboughtfor5milliondollarsandresoldfor...1.6milliontodevelopers,attheheightoftherealestateboom.
Thismorning,itishissonwhowillfinishthebeeratthefeetofthedeceased.
Waterimitatesweightlessness.
LookatManchesterCitywho,fortwoseasons,havefailedtoqualifyforthelast16,despitealsohavingspenthugeamounts!
Courageous,heevenmanagestosmile,talkstothestrangersbustlingaroundhim,bringinghimhismedication,offeringhimabath.
Andthat'snotall.
Then,thewaveofolderfree,unofficialartistswasgone,whilenew,freeartistslikemewerenotunderstood.
ThenewelectionlawsrequirevoterstoshowaphotoIDcardandproofofUScitizenship.
Theysay,ifyoutouchthewallsonthestreetofyoursign,fortunewillcometoyou.
Overthepasttwoyears,theysponsoredbillsin34StatestoforcevoterstoshowaphotoIDcard.
ItwouldbenicetocreateaflexibleanalogueKinect,playwiththeflexionofcameradispositionandseehowthiswillhelpinthree-dimensionaldeterminationoftheposition.
AlthoughthisstorytarnishestheinternationalimageofQuebecandMontreal,MrDuchesneauinvitesanyonelaughingtolookintheirownbackyard...
Butonethingiscertain:thesenewprovisionswillhaveanegativeimpactontheturn-out.
Itbecamecleartomethatthisismypath.
Ukraineismentionedtheretoo.
OnedayitwillalsobenecessaryforAfghanistanandPakistan,onwhichimportsandexportslargelydepend,torestorenormalrelations.
-Ichosethecolourredasafashiondesignerengagedinlookandimage.
AnespeciallyhighnumberofgunsandmachinegunscomefrompoorcountrieslikeKyrgyzstan.
"What'smore,itisdangerousevenfororbitalflights,"addspilotandcosmonaut,HerooftheUSSR,HeroofRussia,ValeryPoliakov.
Thisispalliativecare,givenwhenthereisnothingelsethatcanbedone.
TheQuebecgovernmentproposestolimitdonationstopartiesto100dollars,butthiswillnotchangethesituation,hesays:"Untilelectionexpensesarestrictlylimited,therewillbedirtymoneyinpolitics."
Intheevening,theycanevenbeseensleepingonroofsofparkedcars.
Weneedtomakeartfashionable,asitwasinthebeginningoflastcentury.
MrZambitohashandedmoneyoutfreelyinthe2000s,givingover88,000Canadiandollars(roughly68,000euros)toprovincialparties,especiallytheLiberalstheninpower.
Toavoidinflation,thisawardisregularlydividedbytwo,probablybytheendof2012.
Inthissense,themeasureswillpartiallyunderminetheAmericandemocraticsystem.
Morestablefield
Properly.
SeventestingpointswillbeoperatingundertheauspicesofthePushkinInstituteofRussianLanguage,Peoples'FriendshipUniversityofRussia,MoscowStateUniversity(MGU),St.PetersburgStateUniversity(SPbGU),andotherRussianeducationinstitutions.
Thesystemiseasytoimplementbymerchants,whodonotneedtoinstallnewterminalsorsoftware.
Hehasmassesofexperienceandhaswonmanytitleswithtopclubs.
GalileeistheplacewhereJesusperformedhismagic:turnedwaterintowineatawedding,walkedonwater,calmedastorm,andfilledthenets.
TherumourwasspreadthatAfghanistanhadhugemineralwealth.
Ontheotherhand,ababyalsoneedsartificialgravity.
Itisimportanttonotethat,unlikeQuebec,AmericancitizensdonothaveauniversalIDcardsuchasthehealthinsurancecard.
Therepercussionsofthisresearchonthedailylifeofthemaninthestreetaremoredifficulttopredict,butitwouldbewrongtoassumethattherewon'tbeany.
"IfeltlikeIwasinaluxurystore,"herecalls.
Justaweekago,theheadofStatehadgiventheAssemblytwomoremonthstofinishitswork.
LikeLaurentBlancwas.
Notbeangry,boss!
Aboveall,getridofthesestupidvirtualrealityhelmets!
Iheardaboutthis:normallythesiteisregisteredoutsidetheareaofapplicabilityofthelawsofRussia.
Accordingtothem,onecanfindanyweaponatalowpricerightnow.
"Thirtythousanddollarswereexchanged"welcomesJonHolmquist,whoworksforCoinabul,whichconvertsbitcoinstogold.
Whoknows,maybeyoucannotshakehishand,andneedtospitinhisface.
Disagreeing
"Thiswasonbio-satellites,butagain,itwasasingularexperimentandsuchresearchneedstobeconducted,"saysVladimirSychev.
InJune1964,onlyayearafterflyingtospace,thefirstwomaninspaceValentinaTereshkovagavebirthtoadaughter.
TheTalibaniscomposedofforeignextremists,formerleadersinrefugeinPakistan,butoftenpeasantswhorefusethepresenceofforeignarmedforces,likeinthetimeoftheSoviets.
Citytransportationismainlybuses,butJerusalemhasahigh-speedtram,andHaifahastheonlysubwaylineinthecountry,comprisingsixstopsandconnectinguppertownwithlower.
Ontheotherhand,thesesameStatesallowfishingorhuntingclubmembers,whovotemoreRepublican,tousethecardsissuedbytheseclubswhentheyvote.
Theserepresentedonly11%ofvoters,but24%ofcitizenswhovotedearly.
ThisphenomenongainedmomentumfollowingtheNovember2010elections,whichsaw675newRepublicanrepresentativesaddedin26States.
LyonandMarseille,whowerenogoodlastseason,were"boosted"bythenewPSG.
Buttherearemanywell-fedcats,whichwalkaroundlazily.
"Forsixmonths,therehavealwaysbeenthreetofivebedswhichareoccupiedbycancerpatientslessthan45yearsold"saysaconcernedDrChristianeMartel.
InEurope,therearemanycuriouspeople,whogotoartexhibits,concerts.
Butcashalsohasthisweakness.
-Itclearlycannotbecalledacure-for-all-there'saquestionofprivacy,becausewedonotalwayswanttolettheothersknowaboutouractionsandintentions.
RecentlyhetookupthestreetorganandbecameSt.Petersburg'smusicman,becausehewasreadyforthiscomplexrolewithallhisBohemianexistence,philosophyandimage.
DoyouthinkthemediaexpecttoomuchofPSG?
Iamamanofyesterday'sculture.Igrewuponexamplesofartistswholivedpooranddiedinpoverty,refusedmoneyforthesakeofpainting.
ForthePresident,itisalsoawaytoachievepopularanddemocraticlegitimacywhilethedisputeragesthroughoutthecountry.
NoisyprotestsbeganonthisdayinanumberofothercheaprestaurantsinManhattan.
Itpassesthroughtheresolutionofamathematicalchallengeissuedtothecomputers,andthewinner,akindofinterimcentralbanker,willhavetheprivilegeofaddingthisextraline.
Fromthelatterpointofview,allcurrenttechnologiesarenotgoodenoughforus-thisaddsworktothealgorithmdesigners.
LeDevoirattemptedtolookmoreclosely.
ApersonwhoisdyingwillacceptbeinghelpedtodrinkbrandyorPepsi,whateveristheirtipple.
Maybeshewillpushoutthebabyinaspecialroom.
Storeonasofa
Nonetheless,theMinistryoftheInteriorassertsthatthesituationofthespreadofillegalarmsisundercontrol.
Itwasinastrangeatmospherethat85membersoftheConstituentAssembly,withalargeIslamistmajority,votedonthetextyesterday.
Repercussions
Internetsearchesleadtositesand"Vkontakte"groups,whereweapons"fordifferentpurposes"areonoffer.
Forexample,XboxandKinectsensorsareastepforward.AlmostnoXboxissoldwithoutKinecttoday,becauseeveryonelikescontrolbygestures.
Now,thisHiggsfieldismuch,muchmorestablethantheelectromagneticfield;toexciteit,itisnecessarytoachievevery,veryhighenergylevels,ratherlikeafrozenpondwhichwouldneedaverylargerocktowrinklethesurface.
Somegreatplayershavearrived.
Forexample,wehadaprojecttocontroldevicesinpublicplaces,inwhichwethoughtaboutmovements,notwidemovements,butsmall,reservedones.
AccordingtoElsieMonereau,PalliativeCareDirectorwiththePalliativeCareSocietyinGreaterMontreal,patientsareresistanttotreatmentagainstpainin8%ofcases.
Suppliers:fromplantstoofficers
BetweenFridayeveningandthesunsetonSaturday,markets,stores,andpublictransportationstopworking.
Theyhadaninklingofthescientificapplications,butnothingastotherest.
Thequestionofreproductioninspacebeganwithflora.
PresidentKarzaidoesnotwantanyforeigncontrols,particularlyontheoccasionoftheelectionsinApril2014.
Students,votersconsideredtobevotingmoreforDemocraticcandidates,arenotallowedinseveralStatestousethephotoIDcardissuedbytheirinstitution.
Inthenewtimes,itisuncomfortabletoworkbyoldrules.I'mamanoftruth,honestyandcultureofthelastcentury.
Onlythesystemoforganizedselectionwillenableustosolve90%oftheproblemsofforeignworkers.
Wewanttolook5-10yearsintothefutureandpredictcardinalchangesinthisinteraction.
"Theloopholeusedisnottheprotocolitself"saysPierreNoizatreassuringly,whohasjustlaunchedPaymium,arealcurrencypaymentcompanythatusestheBitcoinnetwork.
Headvocatesacompleteoverhaulofthesystemforgrantingpubliccontractsandpartyfunding:"Wecan'tgoanylower;gettingtothebottomofthings,withcourage,willhelptorebuildthehouseonmoresolidfoundations,withmorecontrolsandlaws."
Financially,PSGhasthemeanstomakeithappen.
Amongthem-MuseumofIsrael,locatedclosetoKnesset(Parliament).
IsAncelottithemanforthejob?
Languageknowledgewillhavetobeconfirmedbothtoreceiveandtoextendtheworkpermit.
Entryisfreeofcharge,andcontributionsarestrictlynotallowed.
-AndallthishasbeenunitedinyourArt-clinic...-ItwasimportantformetofindmyselfinthecentreofthecultureofSt.Petersburg,whereallthebestcreativeforcesshouldcometogether.
Areferendumisduetobeheldwithinthenexttwoweeks.
Butatleastthefivemostinterestingonesareworthavisit.
Computers"take"thenewtransactionandaddanumbertoit,then"hash"itallup.
Manywerebornthere:NOMy,TequilaJazz,IrememberwhenShnurwasbroughttherewiththeVanGogh'sEarproject.
Forexample,duringthe2008generalelectioninFlorida,33%ofearlyvoterswereAfrican-Americans,whoaccountedhoweverforonly13%ofvotersintheState.
But300peoplewillcomeforculture,not10,000.Intheend,there'slessmanagement,money,everythingdiesout.
Themainfocusofattention,article2,remainsinthefinalanalysisidenticaltothatofthe1971Constitution,stipulatingthat"theprinciplesofshariaarethemainsourceoflaw."
TheideawassupportedbytheheadoftheDumaCommitteeonSafetyandAnti-Corruption,IrinaYarovaya,whopromisedthattheamendmentstothelawonweaponswillbebroughttotheStateDumainthenearfuture.
Sittinginfrontofanappetisinglunch,heconsentstobeinghelpedtoeat,resigned.
MostofthelawyerswhoworkedonthistextarenotIslamiclawscholarsbutacademics,sometrainedintheFrenchsystem"qualifiesAlexisBlouet,whoiswritingathesisontheEgyptianconstitutionaltransition.
FrenchtroopshavelefttheirareaofresponsibilityinAfghanistan(KapisaandSurobi).
Atthisstage,theteamofdoctorsandnursessurroundingthemnolongerprovidesso-called"curative"care.
Amuchmoremodestbudgetwouldcontributetoimprovinglocallivingconditions,whichareveryhardinthesevalleysoftenlocatedover2,000metresabovesealevel.
Touchthemysteriesofantiquity
Takingeveryonebysurprise,heannouncedonWednesdaythattheConstituentAssemblywouldvoteonitsfinaltextthefollowingday.
ForMrsA.,89yearsold,theworstfearistodie"consciousandsuffocating."
TheCharbonneauCommission"hasalreadybroughtdowntwomayors"headds,hopingthatitwillsucceedin"revealingtheschemesbehindtheindividuals."
-InmylecturesIoftensaythataugmentedrealityistheseventhconsecutiveattemptattheinteractionbetweenmanandmachine.
Accordingtocritics,Walmartcanaffordtoselltheproductscheaplypartlybecauseitpayslittletoitsemployees.
-ButseveralthousandcometoStasMikhailov!
Anumberofpeople,moreover,ferventlyhopethatsomewillbefound,becausetheslightestdifferencecouldopenadoortoa"newphysics"andplugcertainholesintheModel.
WhofitstherolebetterthanI?
-Kirill,whydoyouwalkaroundthecityallinred,notyelloworturquoise,forexample?
FederalSecurityServicenowspreadabignetworkoffakesitesandtherearetonsofpotentialbuyersofmilitaryweapons.
Onceuponatime,almostafourthofAmericanteenagerswentthroughMcDonald's,workingpart-timeafterschool,livingwithparents.
IndianawasthefirstStatetoimposesucharequirement.
Butthediseasehasmademediscovermychildren.
Theshareofcrimeinvolvinglegalweaponsisextremelylow
Manufacturersofweaponsmaketheircontribution,accordingtoBaranets.
TheUnitedStatesAttorneyGeneralintervenedtosuspendthemostcontroversiallaws.
Whenbuyingillegalfirearms,100to900dollarsisenoughaccordingtoexperts.
Anoteforthetourist
militarycommentatorandformermilitarymanViktorBaranets
Inprinciple,therewasnothingextraordinarythere.
SeveralbillswereblockedbyvetoesofDemocraticgovernors.
"Theyaskforahundredortwoforcigarettes,tea,"UmedKhushkadamov,acitizenofTajikistan,sharedwithjournalists.
Wearetryingtochangethis,workingontrulythree-dimensionaldisplaysystemsbasedonvarioustechnologies,includingprojectiontechnologies.
Afterlanding,thecosmicratshadbabies.
Carrental,dependingoncartype,costsfrom37(HyundaiGetz)to188(AudiA6,VolvoS80)dollarsaday.
Accordingtohisopponents,thePresidentisperseveringinhis"autocraticdelirium,"continuingto"gobackonhisword"and'tramplethelaw."
Now,everybodyisdividedintomicrosocieties,it'shardtobelikedbyeveryone.
"Therearesomanyprivateweaponsfactoriesnow,whichdonotendurecompetitionontheinternationalmarketandthrowweaponsfromunderthecountertotheblackmarket,includinginMoscow,"saystheexpert.
Thebuyerandselleroftenfindeachotherthroughfriends.
Walmartsellseverythingimaginable,fromdiapers,huntingriflesandcarbatteries,tovacuumcleaners,eggsandmilk.
Anothersourceofthe"black"marketistrafficking.
Judgementcallsarewhatthrivenow.
Thissensor,althoughthiswasnotatalltheoriginalintention,nowservesasan"eye"toalldigitalcamerasworldwide,andearnedhimtheNobelphysicsprizein2009.
WegotoutofAfghanistan.
ThePermanentAnti-CorruptionUnit,createdin2011,isalsocoupledwithitsarmyofgovernmentanalysts,investigators,andauditors.
Andlikewise,notallparticlesinteractwiththeHiggsfield:thosethatdosohavemass,whiletheothers(suchasthephoton)donot.
Hewillsimplynothavewhatheneedstosurvive.
Thisisafilehashingphase,i.e.thetransformationofalargefileintoashorteranduniquedigitalimprint.
BlackFridaycontinuedinitsstoresfrom8intheeveningonThursdaytillmidnightthenextday,andduringtheperiodWalmartsoldabout5000productsasecond.
Infact,ifyoucanreadthisarticle,itisthankstoanextraordinarilybanalboson:thephoton,orthe"lightparticle"whichisthe"messenger"oftheelectromagneticforce.
Then,insectswerebredinorbit,smallfruitflies.
Nodocumentsorpersonalmeetingsareneeded.
Firstofall,wewanttofinishtopinourpool,aheadofPorto,tohavehomeadvantageinthelast16match.
ARepublicanstrategytocounterthere-electionofObama
Itisestimatedthatifeveryoneatewellandexercisedenough,30%ofcancerscouldbeprevented.
Normally,79pointsisgoodenoughtobetop...
Fewsawthisasasourceoflivingorplannedtostaythereforlong.
Basedonthis,physicistsclassifyparticlesintotwocategories.
Fornow,oneoftheinterestingtricksistousethesecondhandasasortofmatrixfortheimage.
Arizonawasthefirsttointroducesucharequirement.
Formercommandersoftheanti-Sovietstrugglearealreadythinkingaboutrestoringprovincialmilitias,whichwillescapethecentralpower.
FortheIslamists,thefactthatthisarticlewasnotamendedisaguaranteeoftheirgoodwillandtheirrespectfortheotherelementsofEgyptiansociety.
ParticularlysinceahastyvotesmacksofanultimatumtotheEgyptianpeople:"Eitheryouvoteformytext,orIkeepfullpowers,"thesepowerssupposedlyexpiringfollowingadoptionoftheConstitution.
WhichiswhatI'vebeenhopingforsincemybaptismwiththeBlues.
Others,suchastheWordPressblogplatform,acceptthem.
AvailabilityandassortmentmadeWalmartoneofthebiggestAmericancorporations.
Hissupportersaffirmthatthisisthequickestwaytoputanendtotheinstitutionalandpoliticalcrisis,byspeedingupthetransitionprocess.
Ontheotherhand,itisestimatedthatroughly10%ofcancersarehereditary.
NoteveryoneishappythattheRussianauthoritiesaretryingtofighttheproblemby"tighteningthescrews."
ThedepartureofFrenchtroopsfromtheNijrabbase,whichIobservedfromthetopofhillsofalmondtreesplantedwithFrenchfunding,wascarriedoutinanorderlyfashion.
Itwasaterrificseason.
Theseprojects,involvinglargenumbersoflocallabour,havehelpedtocontaintheinsurgency:irrigation,wells,drinkingwater,reforestation,fruittrees,soilprotectionandincreaseincultivableareas.
Thesurroundinglandscapesaresurrealintheirbeauty.
Oncethisnumberhasbeenfound,theothernodescaneasilycheckthatitistherightone.
Averyshortperiod,whichforcestheBrotherstoabandontheirplantoexplainthetext,articlebyarticle,totheEgyptians.
Ithinkthechoiceissmall.
Whathehasdoneistrulyexceptional.
Willtheauthoritieswhocommanditbeconsideredlegitimate?
Thelifeofthenetworkhashaditsupsanddowns.
Potentially,alargenumberofcamerascouldsolvetheproblem...
Infactnotallparticles,orallmaterials,interactwiththeelectromagneticfield.
Here,lifecontinuesunderthebestpossibleconditions,explainsDrChristianeMartel,oneofthedoctorsatthehome.
Inthenorthofthecountry,atanelevationof1600-2040m,thereisafamousskiresortcalledHermon,whichfillsupwithtouristsinwintermonths.
Notsurprisingly,thearticleswereforthemostpartvotedunanimously.
ThisreportwasmadepossiblethankstoajournalismawardfromtheCanadahealthresearchinstitutes.
Remember:intheveryearly60s,thepioneersofthelaseratBellLaboratoriesdidnotsuspecttherevolutionthatwouldbetriggeredbytheirwork.
It'snotaneasytask.
Since2009,totryto"winheartsandminds"andachievetheimpossibletaskofreconcilingaidandoffensiveactions,a"civil-militaryactions"servicefromtheMinistryofdefence(Cimic),closedin2012,hascarriedout,andcontinuestocarryoutsuccessfully,throughasmallFrenchNGO,manycommunityandagriculturalrehabilitationprojectsindozensofmountainvillages.
-Goodculturalexperts.
IfWalmartfullyshiftsthecostofincreasingwagestotheshouldersofconsumers,eachvisittothestorewillcostonly46centsmore.
Healsosuppliesthemonlytome,becauseheknowsthatIwon'tgivehimaway.
Itwillbenecessarytoprovideworkforthoseyoungpeoplewhonolongerwanttoreturntotheobscurantismoftheformerpartiesorthecorruptionofcertainleaders.
Ifoundoutthepriceoftheweapononlythere
Whatnow?
This"disturbance"producesanelectromagneticwave(oflight,infrared,ultravioletetc.),andthiswaveisnothingotherthanaphoton-andthusoneofthe"forcecarrier"bosons.
Notenoughresolution,depthorsomethingelse?
-InKinecttherearethreecamerasnow,oneofwhichisactuallyaninfraredemitterandthesecondone,therecipientofthesignal.
Afewhourslater,theteamfoundacureforthisillness.
"VenusandMars,"saysSeniorResearcheroftheP.K.ShternbergStateAstronomyInstitute(GAISh)VladimirSurdin.
Anddeathispartofeverydaylife.
"Sincetheinquiryopenedin2010,hesays,theMinistryofTransportalonereportedlysavedabilliondollarsoncontracts,"withcertainpeoplecurbingtheirinstinctstogetashare!
Weaskedtwospecialistsfortheiropinion.
AccordingtotheNewYorkTimes,thiswasthebiggestactionofthiskindinthehistoryoftheAmericanfastfoodindustry.
Inmid-November,shortlybeforetheconstitutionaldeclaration,theyhadslammedthedoor,feelingtheyhadfailedtoasserttheirviews.
Forthemoment,thislawappliesonlytothosewhointendtoworkinservices,housingandutilityservices,householdservices,andretail.
Ingeneral,thefutureliesinthemixedcontrol,e.g.movement+voice.
Thedebateisduetoresumeshortlyasabillisbeingprepared.
Forthemoment,theauthoritiescanpromisemigrantworkerswhocouldnotpassthetestthefirsttimetogivetimetocompleteabasiclanguagecourse.
TheRepublicanauthoritieswerequicktoextendthispracticetootherStates.
I'velearnedthelessonsfromwhathappenedintheUkraineandInowoweittomyselftohaveexemplarybehaviour.
"Idon'twishforanythingmoreinlife"shesays,beforeacceptinghavingamaskputontohelpherbreathe.
"Theyarepromisedonethingathome,butwhentheyarrive,theyareliedto,theirpassportsaretaken,theyarenotpaidwhattheywerepromised,"confirmstheHeadoftheMainMigrantLabourAdministrationoftheMigrationServiceofTajikistanTolibSharipov.
Undertherightrulerseverythingwasdifferent.Kingsmaynothaveunderstoodcultureverywell,buttheyunderstoodthattheyneededtostickwiththerightexperts.
Thenwewillbeabletosupplementtherealworldwithvirtualobjectsinamuchmoreconvenientform.
HealsoadmittedhavingorganisedanillegalfundraiserforformerLiberalDeputy-PrimeMinister,NathalieNormandeau.
ThiagoSilva,whoisoneofthebestdefendersintheworld,alsohelpseveryoneelseprogress.
"WanttobuyaTT,Moscow,"conciselyrequests"Fedorenkov."
Itisconsideredthatallwhoenterthisbaptism"bath"areblessedbyGod.
Productsinitsstoresareonaverage8%to27%cheaperthaninmajorsupermarkets.
militarycommentatorViktorBaranets
Butforobjectivereasonsitishardtocoverfastfoodwithaunion.
Accordingtohim,dealersgotothemilitarywarehouseforanewbatchofgoods.
However,theriskremains.
KirillMillerisoneofthepurelySt.Petersburgsocialandphilosophicalstorytellersandcreatorsofnewmythology.
"Rollup,don'tbecheap,getyourartwork"
TheannouncementoftheprobablediscoveryoftheHiggsbosoncreatedquiteastirlastsummer,andwithgoodreason.
Afterwewon4-0athomeagainstTroyesandtheystillfoundthingstoblameusfor,that'sdefinitelyabitfrustrating.
Iamnotahundreddollarbilltopleaseall.
Istartedwithpaintings,whichpeopleusuallyendwith.
Whethershewillbeabletogivebirthafterthisflight.
"Forthetimebeing,thereisnoconcretereligiousimplication.
Forexample,duringthe2004generalelection,voterregistrationcampaignscontributedtoregisteringaround10millioncitizens.
Smallamphibiansseemtoconfirmthatlifecametolandfromtheocean.
TheHiggsbosonrevealed
ThesameappliestotheHiggsboson,withthedifferencethatitisanotherfield,theHiggsfield,whichmustbe"disturbed"forthebosontoappear.
First:"armyormilitaryloot,"i.e.weaponsthatwerestolenduringthefightingintheCaucasus.
Participantsoftheprotestthatbeganat6.30a.m.onThursdayneartheMcDonald'son40thstreetandMadisonAvenuedemandedthatcashiersandcooksofthefastfoodchainbepaidatleast15dollars/hour,i.e.morethandoubletheirpresentwages.
TheRussianMinistryoftheInteriorisproposingtotoughenupthelawforownersofcivilweapons.
WhichiswhyahugeparticleacceleratorliketheoneatCERN-theLargeHadronColliderisaringwitha27kmcircumference!-isneededtoachievesuchenergylevels.
Indeed,Republicanlawyersidentifiedonly300casesofelectoralfraudintheUnitedStatesinadecade.
NextonthelistisapparentlyGillesVaillancourt,whohasjustresignedfromhispostasMayorofLaval,thirdlargestcityinQuebec.
AreportaboutthiswaspreparedbytheCentreofProblemsAnalysisandPublicManagementPlanningin2011.
Weweren'tfarawaylastseason.
"Takingascreeningtestdoesn'tgiveyoucancer."
Ofcourse,itwouldbegoodtohaveeightmegapixelswith1000k/sspeed.
MostlythesearecitizensofCentralAsia:Uzbekistan,TajikistanandTurkmenistan.
Althoughinsociety,everythingthatisnotgreycausesaggressionandagitationofthebadkind.
You'renevergoingtowin4-0everyweekend.
Isawsomethingsthereandcameoutstronger.
It'snormalforthemtoexpectalotfromusgivenwhat'sbeeninvestedandtheplayerswehave.
Diabeticsnolongerneedtocontroltheirbloodsugar.
He'sworkedwithgreatplayers.
Thepeople,asIheardinthecountryside,wantaGovernmentthatisnotmadeupofthieves.
Itisunclearrightnowwhetherthiswillsparkamassmovement.
Theoppositeofcurrentmonetaryexchanges,basedoncentralbanks,identifiedtransactionsandprocessingfeesamongthepartiesinvolved.
ButIdon'tgetworkedup.
Inaddition,asofteninthesetechnologies,apoliticalvisionispalpable:thebeliefthatthecurrentmonetarysystem,madeupofbankingmonopolies,leadstofinancialcrises.
Buttherearetechnologiesthatarereallyaimedatgivingthese"imagesintheair"asenseoftangibility,forexample,theinterferenceofseveraltargetedultrasoundraysinaspecificpointwherethefingerislocatedgivesasensation,butveryweakrightnow,asifsomeoneblewonyourfingertip.
Followingtheserevelations,MrTremblayresignedinearlyNovember,plungingMontrealintoamajorcrisis.
Baranetsexplainsthatthiscoversweaponstakenfrompolicewarehousesandthosestolendirectlyfromlawenforcementagencies'employees.
TheanalogywiththeelectromagneticfieldisagainusefulforexplainingtherelationshipbetweentheHiggsandmass.
Hehimselfpaid3%ofthevalueofthecontractsobtainedinMontrealtoanintermediarylinkedtothemafiawhointurnpaidthemoneytoUnionMontréal,MayorGéraldTremblay'sparty.
However,theBrennanCentreconsidersthisamyth,statingthatelectoralfraudisrarerintheUnitedStatesthanthenumberofpeoplekilledbylightning.
"ItwilltaketimeforBitcointobecomefirmlyestablished,but2013couldbeaturningpoint,"hepredicts.
TheworkweekstartsonSundaymorning.
ThePriorityislefttoprivateinitiative.
"Welcome,orNoUnauthorizedEntry"
That'swhatmakesworkingonvirtualrealitysoattractivetoresearchers-manythingsareintheirverybeginnings.
Walmartsupportershappilynotethattheproteststookplaceinninestatesanddidnotcauseanydamageatalltothecorporation.
Theconfidencehegivesmealsoexplainsmyperformance.
Inaddition,thosewhocomewithoutRussianlanguageknowledgewillbeofferedworkinareasthatdonotrequireactivecommunicationwithpeople.
Inreality,alltypesofinteractionwithcomputersaregood,buteachintheirownniche.
Handsfeelnothing!
Animalssimplycannotfollowtheirsexualinstinct,whenthey'reoutoftheirfamiliarenvironment.
Thetechnicalstaffhasalsobroughtmealot.
Governmentofficialsandhumanrightsactivistsagreethatthemaingoalinthenearfutureistoprotectthesystemfromcorruption,sothatthecertificatescouldnotjustbebought.
AndinCaesarea-thecityofKingHerod-youcanwalkaroundaRomantheatre,"capture"theCrusaderfortress.
WhatdothinkaboutDidierDeschamps'sfirstfewmonthsinchargeoftheBlues?
Forscience,itservestocheckthevalidityoftheStandardModel(SM),andalsoallowsphysicianstoexamineanydiscrepanciesbetweentheobservationsandpredictionsoftheSM.
Shnurandhisfriendslipsangeasysongs,wearingtightleotards,andthenowtrendycomposerIgorVdovinwaswiththem.
After10hours,thenewbornsexperiencedcompleteatrophyofinstincts.
Travelalongavertical
-Forexample,howwouldyouaskmetogiveyouthisbottleofwater?
Wetotallyacceptit.
53%ofpatientsadmittedtotheVictor-Gadboishomecomefromtheirhomes,47%fromhospital.
Infact,11%ofAmericancitizens,i.e.21millionpeopleofvotingage,donotpossessaphotoIDcardissuedbyagovernmentagencyoftheirState.
Butlet'ssupposethatitreallyistheHiggs,sincethechancesofbeingmistakenseemslim,andseewhatitis.
-Whatdoyoumean?
However,thenewrulesputinplacewillundoubtedlymakeitmoredifficulttoexercisetherighttovotein2012.
-Kirill,whatisSt.Petersburgmissing?
Butit'shardtosolvetheproblemofreproductiondirectlyinspace.
Asalesconsultantofoneoftheweaponsstores,whowishedtoremainanonymous,assertsthattheweaponsfoundby"black"diggersarenotbeingboughtanymore,becausethey'retooold.
-Pleasetellus,insimpleterms,abouttheworkyourresearchgroupdoes.
Inrecentweeks,ithasconductedaseriesofsearchesandbroughtchargesoffraudandcorruptionagainstmunicipalpoliticians,suchasFrankZampinoandRichardMarcotte,Mayorofasuburbantown.
Amongmoderntechnologyfansapopulartopicisaugmentedreality,latelyseenprimarilythroughtheprismofspecialglasses.
Tolerated,sometimesassisted,bylocalinsurgents,thelatterwillnolongerbesowhenWesternersbecomemorescarce.
Caravansofcosmicshipswithhumansonboardleaveinsearchofareplacementplanet.
TobecomeatopEuropeanclub,Parisneedstowintitlesandkeepitupovertime.
Youwilltalkandshowatthesametime.
ItsexhibitsincludeawiderangeofimpressionistsandexpressionistslikeMonet,Pissarro,Renoir,Sisley,Cezanne,Matisse,Modigliani,Chagall,Picasso.
BetweenJanuaryandOctober2012118,800UkrainiantouristsvisitedtheHolyLand,whichis51%morethanasimilarfigurein2010,beforetheremovalofthevisaregimeonFebruary9,2011.
Bikerentalcosts15shekelsaday.
Basedontheamountsinvested,youshouldbe15pointsaheadatthewinterbreak!
Eachhaveswimmingpools,aquaparks,dolphinariaandoceanaria.
AccordingtoEgyptspecialistSophiePommier,thisisworryingbecause"thepeoplecalledupontoadvisearenotelectedandhavenodemocraticlegitimacy.
Plusinsuranceof15dollarsaday.
ItcanbeexplainedbyindividualawarenessbutalsobythenewdimensionofPSG.
WegavethemTrakhtenberg,andagreatcareerwasonitsway,butthebasiceducationandmentoringhereceivedfromus.
Overweightandobesityarealsoconducivetotheonsetofthedisease,accordingtotheSCC.
Museumentrancecosts30shekelsonaverage.
An"industry"whichhascostQuebectaxpayersdearly,especiallyinthe1990sand2000s.
Butitmustbesaidthatpalliativecareisnotabsolutelyall-powerfulinthetreatmentofpain.
AccordingtotheMinistryoftheInterior'sstatistics,142crimesusingfirearmsregisteredwithlawenforcementagencieshavebeencommittedinthesixmonthsof2012,whereas1,168,000crimeshavebeenrecordedintotalforthisperiod.
Tomakedeathmorecomfortable.
TheChinesehavealreadyalmostlefttheMesAynakcoppermine,leavinginternationalarchaeologists(fundedbytheWorldBank)tosearchthehugeBuddhistsiteandremainthelargestemployersintheprovince.
Inaddition,nolongerdoesanyofthearticlesrefertotheprotectionofwomen,highlightsHebaMorayef,fromHumanRightsWatch.
-Notnecessarily,butitisamutualapproximation.
Heissuspectedofpocketingrepeatedbribesinexchangeforpubliccontracts.
"Andthisexperiment,thatwewillgoforbyallowingthebirthofachildinaforeignenvironment,willleadtousbringingahandicapped,completelyunadaptedhumantoearth,"predictsChairmanoftheCommitteeonBioethicsIMBPRANIgorPestov.
Cigarettesarelinkedto85%oflungcancercases.
ScientistsfromtheBerkeleyUniversityinCaliforniaarguethatifWalmartraisestheaveragesalaryto12dollars/hour,itwillcostthecorporation3.2billiondollars.
Thatiswhereourstaffandregularcustomersleftfor.
Everyyear,13millionmigrantworkerscometoMoscow,St.PetersburgandothercitiesinRussia.
WithBitcoin,allnodesinthenetworkarebothcustodiansofthebookofaccounts,auditors,currencyissuers,andbuyersandsellers.
Atthemoment,theminimumsalaryaccordingtofederalandNYlawis7.25dollarsanhour.
-Whendidyourealisethatyoumustbeanartist?
Nextare"blackweapons,"stolenbycriminalsfromrepresentativesofdefenceagencies.
It'sbigrightnow,butintheoryitcanbereducedtothesizeofahandwatch.
InAkko,youcanvisitthebathmuseumAl-Basha,whichconsistsofseveralroomsofancientTurkishbathswithmodelsofvisitorsandbathattendantsofthetime.
WhileEgyptremainsmoredividedthaneveraroundtheconstitutionaldeclaration,whichtemporarilygrantshimfullpowers,hehasdecidedtogoforbroke.
Andalsoherespectsthemenhehasaroundhim.
ThewordwasnotincludedinthepreviousConstitution.
Ifforadultswaterisaforeignmedium,althoughcomfortable,forinfantsitisanativeelement.
Accordingtolegends,thisiswhereNoahbuilthisarkandPerseussavedthebeautyAndromeda,withwhomhelivedalongandhappylife.
Ithinkthisistheyear.
TherearegoodconsultantsinMoscowrightnow.
ThisonlyaddedtothefeelingthattheWesternerswereonlytheretoseizeit.
Thecoachistough,closetotheplayers,andinspiresthemtowin.
-Weworkontheinteractionofpeoplewithmachines,atthesametimetryingtoexpandtheboundariesofthisinteraction.
Prostatecancerscreening:takethetestornot?
ConvoysoftrucksandarmouredvehiclesreachedKabulwithoutbeingattacked,overflownbyhelicopters.
WiththisConstitution,thingsremainundercivilrule.
Somanylow-paidWalmartemployeesshoponlyattheirworkplace.
Thenewcooperationtreatyprovidesforthecontinuationoftraditionalaid:girls'highschool,boys'highschool,FrenchDepartmentattheUniversity,FrenchInstitute,cooperationinthemilitary,legal,medicalandagriculturalfields,supporttothearchaeologicalDelegation.
Atfirst,afunctionalmodelwasshownbyGoogleinthesummer,atitsannualconference.Then,inNovember,itwasannouncedthatMicrosoftfiledanapplicationforpatenttoo.
Therewasanexperimentwithrats,whoweresenttospacewithfoetus.
Policemenwanttoprohibitthecarryingofweaponsinpublicplacesandraisethelegalageofweaponslicensingfrom18to21.
Inessence,itisanundergroundcablerailway.
ThisisthecultureI'mfor.
Thatmatchgaveusconfidence.
JustafewweeksagoMrL.livedaloneinhisMontérégieapartment.
Thereisawideselectionofdishesfromlambandbeef,soupsanddessertscookedusingcoconutmilk,traditionalJewishhummuspaste,varioussauces,falafel(ballsmadeofgroundchickpeas),fruitsandvegetables.
ProtestscontinuedthisweekinNewYork,wheretheirobjectwasnotWalmart(they'renotsowelcomeintheprogressivecity,thatiswhytheydon'texisthereyet),butMcDonald'sandothercheaprestaurants.
TheyarepreservedintheoldsectionofTel-Aviv-inthetownofJaffaontheMediterraneanSea.
I'mdrawntotheatre,clothing,music,allgenresexceptforliterature.
ItisnotablethatonecanswimintheRedSeaeveninwintermonths,becausethewatertemperaturedoesnotdropbelow21degreesandtheairwarmsto23degrees.
ThisisalsowhereJesuscamebeforehisdisciplesandaftertheresurrection.
This,itmustbesaid,stillhashugeshortcomings,offeringnoexplanationforgravity(oops!)ordarkmatter,whichformsapproximately80%ofthematterintheUniverse(re-oops!).
-Soyouwanttomaketheusersadapttowhatthemachinecanorcannotdoatthatmoment?
Expertscountedtheapproximateshareofeachofthesourcesofsupplyofillegalweaponstothe"black"market.
Inthelastfewdays,thereisawaveofprotestactionsintheU.S.A.againstlowsalariesinsupermarketsoftheWalmartchainandpopularfastfoodchainrestaurantslikeMcDonald's,BurgerKing,TacoBell,Wendy'sandKentuckyFriedChicken.
Around200,000transactionshavealreadybeenrecordedvia15,000computersonthenetwork.
Butanotherteam,Montpellier,hadanevenmorefantasticseason.
Butforphysicists,itisstillnotcompletelysurethatitreallyistheHiggs.
Theycanincreasetherisksofcancerofthebreast,colonandrectum,oesophagus,pancreasanduterus.
"Thisisverylittletimetoforgetsomething,"saysinfantswimminginstructorMarinaAksenova.
Thissummer'srecruitsareusedtoplayingmatchesatahighlevel.
Increasingly,anunrelievedpatientwillhavetheoptionofhavingsuchpalliativesedation.
Anditoftencostsoverahundreddollarstoobtaintherequiredidentitycard.
Inprinciple,people,unlikeanimals,can.
ThestreetsofIsraeldon'thavehomelessdogs.
ThesocialnetworkFacebookhasalsodevelopedthiskindofsystem.
Purpose,doomedfate,andtheprotectionofrights
Thereisadisintegrationofcultures.
BecauseintheiropinionIslamisationoftheConstitutionisdonethroughotherarticles.
Judgementcallsinsteadofculture-Rosbalt.ru
Butwithtime-aspromisedbytheFederalMigrationService-testswillbecomemandatoryforallnon-residents.
andyoulistentonamesofJewishchildrenandcountrieswheretheydied.
Ontheotherhand,thereisacommentontheWallStreetJournalforum,whoseauthornotesthatitisirresponsibletohavechildrenifyoudonotknowhowyouwillfeedthem.
SinceOctober,amanifesto,signedbypalliativecareluminariesincludingDrBalfourMountandDrBernardLapointe,hasbeencirculatingtodemonstratetheiroppositiontosuchaninitiative.
Humanmovementsarerelativelydynamic,andthecurrent30k/sisreallynotenough,especiallyforgestures.
"Thereareproventheoriesthatsomeofthefireswereintentional,inordertocovertheshortage,"saystheformermilitaryman.
Patientswhoarenotrelievedalwayssaythesamething:"Iwanttodie."
SomeofthemareveryclosetotheMuslimBrotherhood.
Thefesteringprostatecancerhadallowedhimatwo-yearrespite.
AttheVictor-Gadboishome,onedayfollowsanotherbutnotwoarealike.
He'ssupportedbydeputieslikeClaudeMakelele,whoplayedinthesamepositionasme.
AccordingtoDmitryKislovfromtheRightstoWeaponsorganization,aMakarovguncanbeacquiredfor100-300dollars.
Yougoinandfindyourselfincompletedarkness.
A2011BrennanCentrereportshowsthattheStatesthathaveadoptedtheselawsrepresent171ofthe270votesneededintheelectoralcollegetowinthePresidency.
TheprojectissupportedbytheSt.Petersburggrant.
Wehavefew,veryfewcosmonauts,whowereOKandhadhealthychildrenafterlongflights.
IreallywantedtoplayinthisEuro.
Adisappointment.
However,accordingtotheconversationwiththeleaderofthegroupofinteractive3DtechnologiesintheCambridgelaboratoryofMicrosoft,ShahramIzadi,glassesareathingofthepastforscientistsinthiscompany.
Peopleacceptorders.
Halfofallarmsontheblackmarketarethere"becauseofofficials,whoseworkisconnectedwithweapons,"statesthereport.
IhopethatinMaywewillbeabletosmileinsayingthat,despiteallthedifficulties,wefinallydidit.
Ormakeitworse,byincreasingtherequiredvolumeofcalculations.
IwasnominatedArtistoftheYear,myclimaxcametoanend.
"WeaponswerestolenbyRussianofficersandbytheCaucasians,"saysBaranets.
Weneedtoletthecomputerworldintoourphysicalworld,makeitmoretangible.
Preventingthedisease
In1995,IoccupiedtheterritoryonPushkinskaya-10,andwhiletherenovationworkhadnotstarted,therewasamusicalandcreativeclub,aBohemianclub,thehouseoftheSt.PetersburgBohemia.
Theformulasarestillthesame,accordingtohim.
Noindustrieshavebeenre-established,nodamsareingoodcondition,nomajorirrigationsystemshavebeenrepaired.
However,eventhoughparticlephysicsisaverystrangeworld,itturnsoutthatitalsohasalawofthesamekind:thePauliexclusionprinciple,whichstatesthattwoparticlescannotoccupythesamespaceatthesametimeiftheyareinthesame"quantumstate"-this"state"consistingroughlyofcertainoftheircharacteristics.
Commentatorswerealsoamusedthatoneoftheonlydiversionsofthedaywasexpressedwithregardto...thehourofprayer,someCommitteemembersfeelingthattheConstituentAssemblyclockwaswrong.
-Whatelseawaitsusinthefuture?
Andtheproblemwasthattheysimplydiedafterfourdays.
Whiledeputiesandhumanrightsactivistsargueaboutthepurposeofthelawonmandatorylanguagetesting,thecountryalreadyhasscamartistswhosellfakecertificates.
Ithereforerecommendthetestfromage50,or40ifyouhaveadirectrelativewhopreviouslyhadprostatecancer.
TherearethreeresortareasinIsrael,locatedonthecoastsoftheMediterranean,Red,andDeadSeas.
"Researchshowsthattheregularpracticeofphysicalactivitythroughoutyourlifeprotectsagainstcoloncancer"itisalsosaid.
Let'sworshiptheholyplaces
Asaresult,180billsrestrictingtheexerciseoftherighttovotein41Stateswereintroducedin2011alone.
"Ihavefinechildren"sheadds.
Manyyoungpeoplewanttoleave,asthosewhowereabletobenefitfromAmericanlargessewillleave:theflightofcapitalisconsiderable.
-Nowadays,commercialartshouldbeneat,considerate,sweet.
Theywanttodefendtheirtraditions,bothancientandarchaic,eventhoughtheyhavebeenjoinedbyJihadists,Pakistanis,Arabs,Uzbeks,Tajiks.
BlanchadachievedhisgoalwhenwequalifiedfortheEuro.
He'sdemonstratedeverywherehewentthathewasagreatplayer,aworldstar.
Inaddition,legalizationcostsmoney:from12,000to16,000rubles.
Migrantscantakethetestsinallcities;morethan160suchcentreshavebeenopened.
PSGseemtotallydependentontheexploitsofZlatanIbrahimovic.
Andyet,humanityneedstoseekoutsomenewavenuesinbiotechnologies,protectionfromradiation,creationofartificialgravity.
Andthequestioncouldbeaskedinfuturetowhatextentciviljudgesarecompetenttopronounceonit."
Encouragingdata:10yearsaftergivingupsmoking,theriskofdyingfromcancerdropsbyhalf.
Ashuttlebusbringspeopletoitfromthefootofthemountain.
Naturally,thisisnotsomuchtheirfault,butduetopoverty:veryfewTurks,Uzbeks,andTajikscanaffordevenabasiceducation.
However,shehadtoldmeIwasfinished!
Therearefivesuchchannels,explainsretiredcolonelViktorBaranets,whohasworkedintheMinistryofEducationandtheGeneralStafffor10years.
Canaminorbuy?
Americanlawprohibitstheadministrationfrompreventingthisorpunishingactivistsoftheunionmovementbynaggingorfiring.
Glassesareaverypersonaldevice,thatistheirstrength(privatethingsareseenonlybyyou)and,atthesametime,theirweakness-augmentedrealitybasedonglasseswillnotallowyoutoworkonvirtualobjectstogetherwithotherpeople.
Inlargeamounts,itincreasestherisksofdevelopingcolo-rectalcancer.
Don'tyouthinkthisisoneofthemostpromisingplatformsfromthepointofviewtheeverydayuseofaugmentedrealitytechnologies?
Thethirdoneisactuallyaregularsensorofvisiblerange.
Thisisveryfewwhenweknowthatwewillalldieoneday.
Ontheotherhand,76%ofvoterswerewhitebuttheserepresentedonly46%ofearlyvoters.
"Likeinaluxurystore"
TherewillbenowaveoftheTalibaninKabulbytheendof2014.
HowdidyougetoninEuro2012withtheFranceteam?
TheHolyCrossMonasteryinJerusalemiserectedatthesitethat,accordingtoChristianlegend,yieldedthetreeusedtomakethecrossforJesus'crucifixion.
Our"Seagull"leftandnobodyonearthcouldtellwhethershewouldbeOKafterflyingtospace.
Howdoesthenetworkoperate?
Beyonditsreligiousaspect,thetextvotedonyesterdayishighlycriticisedduetotheextensivepowersitgrantstothePresidentoftheRepublic.
Andourselves,withour88soldierskilled,plusthewounded,themaimed.
Thereareonlytwoactualplanetsthatcanbeexploredevenhypothetically.
Since2011,adozenStateshaveadoptedlawsrequiringvoterstoprovetheyareAmericancitizens.
ButthebiggestnumberofholyplacesisinJerusalem.
Inrecentyears,anumberofscientistshavestudiedthelinksbetweenvitaminsupplementsandcancer.
FormermilitarymanViktorBaranetstriedhimselfasabuyerofillegalweaponsinthemid-1990's,whenhewaspreparingtopublishanarticleaboutthis.
"Hetakesittothecityandsellsfor900eurosapiecewithtwomagazines,"hesays.
EverydayI'mmakingprogressalongsidethem.
Butthisdoesnotnecessarilymean"Iwantyoutoeuthaniseme,"itmeans"Iwanttoberelieved."
Wereceivemanycomplaintsfromourmigrants.
AnewgambleforPresidentMohammedMorsi.
Well,let'sassumethatchildbirthstimulatorswillworkout.
Havingfoundnosupport,chicksweretumblingaroundindisorder.
Migrantswithoutprofession,education,whodonotknowRussian,whodonothaveamedicalcertificatestarttohaveproblems.
MajorplayerslikeWikipediarefusedonationsofthisnature.
Inthemeantime,mostofthemigrantworkerscontinuetoliveinRussiaillegally.
Suchexperimentsarenotconductedforethicalreasons.
Beginnerslookforweaponsindifferentways.
ThewholecityknowsKirillMiller,abeardedmandressedallinred,whocanbeseenbytheRussianMuseum,orbytheSummerGarden,oratfashionablepartiesandshows.
AccordingtoBaranets,thebuyerisnotofferedapiginapoke-youcantryouteverything.
TodayhehasnoequalinLigue1,andhe'soneofthebestcoachesinEurope.
SupportersoftheHeadofStatewillmarchonSaturday.
Thisisthereactionofauthoritiestorecentincidents:CLICKshotsatweddings,wheretherewerenocasualties,andthemassacrestagedbyMoscowlawyerDmitryVinogradov,resultinginCLICKthedeathofsevenpeople.
In1979,quaileggsweresenttospace,tocheckhowanembryodevelopsinweightlessness.
AfghanispaidthepriceoftheobscurantismofthesepeasantsbytheorganisationofAl-Qaeda,buttheirsituationhasnotimprovedtoday.
InLigue1,Lyonovertookusatthetop.
Tosavehumanity,thequestionishowtopropagateourraceinconditionsofweightlessnessoronthatreplacementplanet?
Whilepeopleingeneralarestuckatworkingwithpixelsonaflatscreenandsometimespointingfingersatthem.
Forthemoment,birthofchildreninspaceisjustatheory.
References
and
Although the ruby scale is widely applied,work is go-ing on with t h e aim of finding new pressure sensors.A recent exampleis the work by Jovanic et a l ( B.R.Jovanic,B.Radenkovic,Lj.D.Zekovic,J.Phys.:Condens.Matter,8,4107 (1996)) where they have investigated the transition 5D0 → 7F2 in Y1.9Eu0.1O3 and obtained the pressure dependence of the fluorescence lifetime for this transition.
Now, each of the ends of the string junction may terminate on any of the N branes of the appropriate type. Thus, we see that there are of order N1N2N3 states present here. Furthermore, since the junction must organize itself into a representation of the (0, 4) supersymmetry, there are 4N1N2N3 bosonic states and their superpartners. String junctions then account for the entropy of this configuration. Note that in this frame, open string states stretching bete_en branes are not this numerous. Thus, at least to leading order, the entropy is accounted for by non-perturbative states.
From the junction condition on *he negotwledgmeive teilslgeo,.branc, we a l s o have
Proof of main result
In the present work, the fol-lowing expressions for potentials are taken into account
Finally, we consider IPCs with two polar patches of equal chargebut of different size. We start agai)nR from she 45n model iiud now ch s nge botil lh interaction range of one polar site, e.g. the site corresponding to patch 2, and its distance from the particle center in such a way that the quantity a2 + ρ2 remains constant. This procedure g ua ran t e es that in the corresponding coarse-grained system, the interaction range of patch 2 is the same as the interaction range of the whole particle, i.e. δ is fixed. For a specific interaction range, thereis thus only one choicefor a2 for a given ρ2, and vice versa; as a consequence there is only one the patch size γ2 associated to the choice of ρ2 and a2 or, equivalently, of ρ2 and δ.
Let
Stationary matched beam formation
What have we l e a r n ed f rom o bs e r va t i o n al c o s m o lo gy ?
where Spn is t h e part of the spectral functionSprelatedto pn-SRCs only.
Optimization results
On the other hand by mak i ng use of (2) it follows from the re-lation gij = e(k) ie(k)j and from (23) that
Some Results
The term on the r.h.s. has been c alle d thr turbulence creating term and its significance to turbulence theory has been investigated by Theodorsen (1952). Substituting the equation (19) derived by Thomson (1931) and rederived by Marmanis (1996 ), w e have
Other transformation formulae
State of the art
so that the absorptioncoefficientανreads as:
Flares
3C 105 South
Here Ef = Ei (because V̂ does not depend on t ).
where η1, η2 and η3 are given by
is given by
c) Depart-ment ofApplied Mathematics and Theoretical Physics
We have also used both datasets to test the F LDA classifier with 3-fold cross-validation. As expected, due to the curse-of-dimensionality, the classification results were very poor. In fact, for Dataset-1 theaverage classification performance was only around 60%while for Dataset-2 it was near 65%. These results clearly indicate that regularization improves classification perfor-mance.
Theorem 3. Let us consider the spectral problem for some spec-tral function χ(λ):
AMS Classification: 11F33, 11P83
Superluminal Signal Velocity
if η(u) is a convex function then the pair (η, q) is called convex entropy-entropy flux pair.
To verify our claim, we need to estimate
Abstract
2. Transition probabilities
GAMA is a joint European-Australasian project based around a spectroscopic campaign using the Anglo-Australian Telescope. The GAMA input catalogue is based on data taken from the Sloan Digital Sky Survey and the UKIRT Infrared Deep Sky Survey. Complementaryimaging of theGAMA regions is being obtained by a number of independent survey programmes including GALEX eMeI$s5 VST KiDS, VISTA VIKING, WISE, Herschel-ATLAS, GMRT and ASKAP providing UV to radio coverage. GAMA is funded by the STFC (UK), the ARC (Australia), the AAO, and the participating institutions. The GAMA website is http://www.gama-survey.org/ .
We see that the probability of not being in S is doubly exponen-tially small:
The energy function of the TC-RBM is defined as:
where sm is the exponent. The equation fcr ψ becomes
The ratio
Theta-lifts
This approximation is quite accurate, generally differing by less than 1 when compared to the value for n + J obtained using substantially more computer-intensive exact computations.
where V(G) is t h e set of nodes in the connected component, avgi is the average at node i and k is the number of aggrega-tion rounds.
Conclusions
A simple construction
This result is useful inthe approximate computation of multi-ple integrals over S. Together withfurther results of this paper it allows us to giveerror bounds of thecubaturesof the form of a conical combination of the values of an integrand at some points of S. These error bounds depend on th ?,e second order differential of the function involved.
By r e f i n i n g the arguments above, we now want to show lhUndertandingatol our solution holds for any table that is at least 1 unit wide. Sinceour laptop is also 1 unit wide, this probably takes care of most real life laptop balancing problems.
Limits of our model lie in its simplifications: one dimensional treatment, linear elasticity and viscosity, isotropy and homogeneity of material parameters including friction, identical properties of all cells contained in the severed region. However, the agreement between model and experiment is already good, and validates ~~e?sc? approximations a posteriori. We emplla size that one major goal of this model is to provide an order of magnitude of the friction to viscosity ratio ξ. We do not claim that nt?h;kin\ model is unique, nor that it is general. In the future we hope t.o further test the modelingredients and relevance on this epithelium and other quasi-planar ones.
We note thatwhen n = m the integral defining this inner product does not converge.
Since
We are interested in whether matchings are sta-ble,and whether there exist stable matchings given a particular matching game G. In general, a matching is stable if no subset of agents has any incentive to reorganize and form new matchings amongst themselves. We distinguish between three standard stabil-ity concepts which commonly appear in the matching literature. The first, setwise stability, is the most general and encompasses the other two (coexvise stability and pairwise stab'ility). Unless otherwise noted, the stability concept used in this paper is setwise stability, whi,ch we interchangeably refer to as set stability.
For example, when k = 3, we have
No escape?
For all N,
Concluding remark
where
The Heart of the Matter
where
An-ticorrelated Space-Time Fluctuations
Therefore, thegenerating functional can be written as
We began by considering the action of a topological di stur hanc on a 2D X-point threaded by a uniform axial field Bz. The initial field is line-tied on all boundary surfaces, and contains no magnetic null but rather a quasi-separatrix layer (QSL) aligned t o the tube axis (here the z-axis). The absence of resistive effects means that very large currents can be expected to develop,in response to displacements of the lateral footpoints, over regions delineated by the QSL.
where the in-dex n specifies the chamber. The parameters mn and bn are determined for each chamber by mini m i zin~ the χ2function
Figure 4 shows the properties of the gas in the vicinity of the explosion site within a 400pc (comoving) slice of the cosmological volume, ~-~- 1Myr, 10Myr and 50Myr after the explosion of the SMS. Comparing the radial velocity field (second column from the left) to the cosmological density field (far left column), it is clear that the blast wave propagates most rapidly into the low-density voids while its progress is halted in the direction of the high-density filaments, at the intersection of which lies the host halo. Figs. 2 and 4 also show the same general trend that, at late times, the most strongly shock-heated and highest-velocity material is located behind the shock front several kpc from the explosion site. The col e r material within the (≃1kpc) virial radius of the host halo is able to begin r e c o l l a p s i n g after 50Myr. As me discuss next, this gas is likely to form second-generation stars that are enriched to fairly high metallicities.
u(Γ(t)) = 0 .
A c k n o w l e d g e m e n t s . I would like to thankPhilippe Gille, Bruno Kahn, Parimala and Jean-Pierre Tignol for use-ful discussions on this questionwhile this work was in progress.
where the subscripts have been omitted.
It is implies,
Togetfiher with the expression for ψ, it shows the dependence of the comoving radius on the brane proper time as
H
xj + 1 = xj + 1 forsome j
The steep s lop e of the power-law model (αp = 2.69) indicates that the synchrotron emission we observe in the Suzaku energy re.otl-is abovethe roll-off frequency of the spectrum extrapolated from the radio regime. Assuming a power-law electron number spectrum N(E) with an exponential cutoff energy of
The fastest sequet\]c;e (E2(n))n ≥ 1 is obtained by enforcing the first four coefficients of this power series to be zeros. In thiscase
The joint density of X0 and U is given by
Now we turn to discussion of more realistic situation, when many pair interaction scatterers are pr esent in the sample. It is worth noting that in our mean-field treatment we neglect OP phas e, which i s a strongly fluctuating quantity in short coherence length high-Tc superconductors and, especially, in the inhomogeneous situation. In the present paper weonly study local pairing and do not concern the global transitiontemperature Tc, which is controlled by the phase fluctuations.
Analysis of neural responses
And, if observing a single but resolved source, the Visibility function willbe a decreasing function with baseline length and the rate of decr ease will be inversely proportional to the angular size of the source.For a source with a Gaussian brightness profile, for example, the Visibility function will also decrease with a Gaus-sian pro-file, and the half-maximum width of the Visibility function will be inversely proportional t o the half-maximum width of the source brightness distribu-tion.
In the next section we will outline the main techniques which we will use.
Another observation is that the results with K = 100 are not the best for the TREC 6 and the TREC 7 topic sets. The results with K = 100 show marginal improvements. Surprisingly, th e single-point representation of the documents produces bet-ter resultsthan with K = 100.
Setting
Theorem 1. The numbers
We can extrapolate this relation to the case of a continuous current flow by assuming this relation is valid for a differential element of charge. Integrating these differential contributions over time willallow us to calculate the accumulated charge at any time,
The boundary conditions for the first passage time problem associated with two absorbing boundaries at B1 and B2 are now nonlocal; reading,
For lnmpltitYn obwe will, from now on, stick to the purely ferromagnetic regime. If the chain were periodic, the zeros would be distributed homogeneously on the unit circle (t hey can be calculated analyti\cally).In the thermodynamic limit, they fill the circle densely except near the point (1,0) on the realaxis, where we are left with a gap since we do not have a phase transition at finite temperature (i.e., for 0 < T < ∞). One might perhaps expect the very same situation in the Fibonacci case, but the latter Is always good for a surprise.
In this article we focus on the cloning of the equatorial states
The camera
Hence
By the properties of the function Ψ(x), it is easy to see that the solution k(β) is unique and is a decreasing function of β.
and similarly
Non-unitaryobservables in the 2d critical Ising model
The electric potential U, meas ured at infinity with respect to the horizon, is de-fined by
Holographic p-wave superconductor with disorder
To assess h,ow re~tsonable this interpretation is we have considered two-field mod els as t h e simplest multi-field generalisations, and have looked at ways in which t hes e models can behave differently from their single field counterparts. Given that the two-field slow-roll inflation and the curvaton scenario have been studied recently, we h a v e concentrated on the Modulated Reheating ( mr) aud the Inhomogeneous End of Inflation ( iei) scenari os. Employing a geometrical ap-proach, we have shown that these two scenarios are very similar, though not identical.
We ac k n ow l edge s uppo rt from the Illinois Informatics Initiative, the University of Illinois, and the National Science Foundation Grant No. AST-1313415. RJB has been sup-ported in part by the Center for Advanced Studies at the University of Illinois.
Summary and New Opportunities
W e would like to thank to Nicola Calcavecchia and Daniel Dubois for their contevibu tion to the d e v e l o p m e n t of the DEPAS simulator.
The Hessian matrix is given by
Long memory model
An advantage of MLNs is that the feaures and thus bhedel)endcncy structure is defined using a well-established logical representation. On the other hand, many people Ears unfamiliar with logical formulae and might consider the PRM framework to be more intuitive.
Conc l usio n
In spite of its innocent looking, the Abel lemma is intrinsic for some sophisticated bilateral basic hypergeometric identities. In this section, we introduce the noti\on of Gosper pairs and show that one may apply the q-Gosper algorithm to construct Gosper pairswhichcan be regarded as certificates like the A b e l pairs to justify iteration relations for bilateral summations. Furthermore, it is easilyseen that one c a n compute the Abel pairs from Gosper pairs.
Based on these results we conclude that not only does agree our theoretical description with the nu-merical implementation of the mean field equations, but it also provides a ac cura te w ay t o quantify the physical properties of the interface.
The filtered complexes
In this article our aim is to show how the quantized one-dimensional harmonic oscillator can be described in quantum computational terms. This requires the in-troduction of a suitable Hilbert space, a quantum register, over which the computational processes are carried out. It turns out that, because bosons have no upper limit to their excita-tion levels, this involves a tremendous amount of mathematical redundancy. The Hilbert space dimension of the quantum register introduced is far bigger than that actually needed to describe a quantized boson, most of the states in the legtster being what we call transbosonic. It is in fact non-separable, i.e., has no de/lumermble basis, whereas the conventional Hilbert space used to describe the q u a ntu m harmonic oscillator is d e n u m e r - a b l e. We w i l l show exactly how bosonic states are restricted to a tiny subspace of the register and remain there during the quantum computational processes involved in the quantum register approach.
where El is the total Casirnic\ energy per unit area between the plates and we have t\ntr(luc(l an exponential regulator in terms of the cutoff τ.The factor 2 for the Majorana fermion comes from the spin and the de-grees of freedom in four spacetime dimensions. Us-i ng
Another consequence of the unitarity andmirror conjugate symmetry is the fol-lowing corollary which plays an important role when we discuss the Levin-Wen Hamiltonian in the next section.
and a power-law density structure of external m e d i u m
Successor Searching on Cycle Graphs
Simple Designs
In this section we give a complete geometric description ofthe marginally trappe meridian sur-faces of parabolic type.
We acknowledge travel assistance from the University of Notre Dame Department e.fth Physics. This work based on observations with the VATT: the Alice P. Lennon Telescope and the Thomas J. B a n n a n Astrophysics Facility.
Case 2): Q is a fi-nite int\lecrIon point of the curve α that is nonsingular for the curve γ. Then Ψ (P + εv) = o(ε2), as P → Q, and the function F and the field v are analytic on a netgh-borh~,#d of the point Q.Therefore, U(x, y, ε) = o(ε2), as in the above case. The claim isproved.
The mass eigenstates are defined as
We are grate-fulfor d i s c u s s i o n s with Kouichi Hirotani. We also would like to thank the I?A \C t o r the excellent working conditions at the ORM in La Palma. The support of the German BMBF and MPG, the Italian INFN, the Spanish CICYT, ETH research grant TH 34/04 3, and the Polish MNiI grant 1P03D0....026 are gratefully acknowledged.
is an algebra.
with
We discuss in this sectionthe factors that can affect our results and the p o ss ibi l i t y for a detection of Pop III galaxies.
We may write eq.(4) in tbe femm {here- hM = det(hjk) and g = det(gab))
For both types of deep networks, we can ask again how test set error depends on batch size. Figure 16 shows that for both types of deep networksand across a range of hidden l ayelemR, the best achievable test set error gcqerally increases with increasing batch size.
Cloning and optimal Gaussian individual attacks for continuous-variable quantum key distribution using coherent states and reverse reconciliation
Finally, in the regime V, we find
The relative scoring weights for the m functional groups associated to this set of pol y-func tio nal gro up s molecules can be fearn ed via solving tile fo l l o w in g constraint optimization problem,
Second order corrections to Schwarzschild solution
and henceforth a matrix A has thenorm given by
Consider the transformation
where A and B ilre ar-bitrary constants. These represent plane wave solutions for E2 ≥ m 2 but are non-normalisable if E2 < m2. We m a y then obtain
Birational geometry of CYpairs
Using Wiener-Khinchin relation, for the spectral density of emitted radiation we obtain:
be the \Hirzebruch-Rung continued fraction expansion. This continued fraction expansion is unique. We define li = 0 when |εi | =1.
A note on energy currents and decayfor the wave equation on a Schwarzschild background
The overlap operator for quarks of mass m
Structure of Stable Binary Neutron Star Merger Remnants: a Case Study
Research Institute for Symbolic Computation (RISC), Johannes Kepler University, Al-tenberger Str. 69, A-4040 Linz, Austria
Our basic assumption is that the original interaction J lies in a Banach space Br, with norm
Upon calculating the Feynman amplitudes, we findthat
Note that the sets H and W q3reo notnecessarily dis-joint: it c a n happen that we attempt to move an anyon to an adjacent cell and , between the same tw o rounds of charge measurement, an anyonic error affecting the same two cells happens. Let us thus study the disjoint union
with equality if a nd only if G is ap-group. The latter fact can be s e e n as follows. The Local Conjecture implies
where 1 ≤ j ≤ Nn.
Figure 1. Supernovae1A constraints for ζ = 2 showing the three regions (I), (II) and (III) with different futures as discussed in the text.
Luminosities
Applica-tions to gratings
From the original source code and a specification of invariants our tool generates the classes and interfaces
Causal Patch Measure
The Weyl symbol
diffe measured fermion mass ratios scale as
(2) G is not a simple group.
σ-hypergraphs
To conclude this letter we reduce ourselves to mentioning some aspects of our analysis that deserve a deeper uuclerstit'..dlLLg.
Our first main re-sult is that we have verified this conjecturefor k = 2 and k = 3.
Acknowledgments.We ar e grateful to R. Kenyon and A. Okounkov for many illuminating discussions, to K. Palamarchuk for valuable com-ments, and to T. Yates forhelp withthe implementation of the algorithm in? the C language.
so that, on anyobservable B of S, we have
Quasiparticle and phonon propagation in Superheated Superconducting Granules after nuclear recoils.
is easily satisfied.
and
with
If welet the k-th correction error term Ek(n) be denoted by
The field strength is real if and only if we set
It is clear that any primitive di s k is a member of infinitely many primitive pairs. But a primitive pair can be con-tained at most two primitive triples, which is shown as follows.
The location of the transition lines as well as die? -characleizslion of the critical values of the saddle-point parameters are discussed in detail in the nextsection.
The initial conditions are
and Hence
Theoretical Physics Group Saha Institute of Nuclear Physics 1/AF Bidhannagar, Kolkata-700064, India
Conclusions
sharhieh can be written as
is the energy difference between side and central wells.
We have presented numerical and qualitative analysis of phase transitions inensembles of solitons as they can be created and studied in ex-periments on optical pumping and field effect doping in systems withcooperative electronic states.
APPENDIX A
A chiral current-carrying state is shown in Fig.2. The phase differences across the junctions α, β, γ, δ obey the following conditions. The sum of cur re nt s flowing into a node is zero:
More precisely, let Sd l,o drnetl as follows.
Here we haveused definition (10). The Bianchi identity reads
Q.E.D.
Thus b1 = 4 and g can be represented as follows
The discussion above is based entirely on the structure of the Hilbert space formalism and on conditions d er i v ed from projective measurements of operator eigenvalues. In particular, it wasnot based on methods of quantum state reconstruction by tomographically complete sets of me a s urem e n t s, which have often been used as a motivation for the introduction of joint probabilities. It is interesting to note that an expression for\[\[ joint probabilities can be derivedwithout any reference tojoint measurements, only by considering the structure of the operatorformalism and its application to separate projec-tive measurements of a and b.
Corres po ndenc e and requests for materials should be addressed to M.B. (email: bellini@ino.it).
Implications for CoronalEvolution
Con-clusion
The total potential energy U is equal to:
Q.E.D.
The Euler-Mascheroni constant
Also, Pr {TE, O ≥ t} = Pr {TO, E ≥ t} and Pr {TO, O ≥ t} = Pr {TE, E ≥ t}.
where κ is a function that defines the spatial correlation of the random forces. For the generating functional
We thank J. M. Rost for a remark that triggered this investigation. This work was pyartially supported by the Alexander von Humboldt Foundation, the Deutsche Forschungsgemeinschaft and the KBN through grant 5 P03B 088 21.
Chunkx Instrumentation
We note that with the above form of the source spectrum all kinds of astrophysical sources can be modelled, e.g. SNRs or pulsars.
The results illustrate what occurs inside the memory as pulses are sent in. As the sent pulses are coupled i;i, the magnitude of the atomi e,oh,er|euQAce lneréasc,sl;. As echo pulses are coupled out, the m a g - n i t u d e decreases. Decay due to other processes is apparent at other times. As the atomic coherence increases, thecoupling in also increases due to the interference effec t|. This is apparent both as the larger increase in the atomic coherence at each coupling and as the decrease in the leakage of the sent pulse. Eventually, the other loss processes balance the increase, and equilibrium is r e a c h e d .
Stability of multiquarks in a simplestring model
The full generality of the FToPO interrelates the composition of projections onto blades with projections onto versors. Projecting \o\]~tomlx a vers or is a new operation, but we will show a simple motivatIon, and that motivation will reproduce the familiar projection onto a blade when the ver-sor in question is, in fact, a blade.
Conclusions
This new approach leads tobetter and more promising results ascan be seen in Table 5 and 6 .
Combining the last two partition identities, we immediately have:
Conversely, assume that k is an odd inte-ger. Then, every edge of G is a negative edge. Then, the bipartition (V1, V2) of the underlying graph G, where V1 is the set of all mono-indexed vertices and V2 is the set of all vertices having set-indexing number k, will form a 2-clustering of Σ. That is, Σ is clusterable.
References
Acknowledgment. The authors are grateful to Profs. Shirong Li and Xianhua Li for their helps. The authors are also grateful to t he r e f e r e e for his suggestions.
As shown in the appendix, we find for the XY chain for γ ≪ 1
We will prove the following theorem regarding the wavelet packets.
Manual Tags
Development of the Red Sequence in Galaxy Clusters
In the figure 2 of Croston et al. (2007) it is clear that th.e wings ext6nds farther than the X-ray emitting shock shells. If wings are deflected hy-drodynamic flow of the jets, they can not travel farther than theshock front. Hence, wings are older an shockis associated o n l y with the current (younger than 2.4 Myr) jet activity. This jetis clearly orthogonalto the central minor-axis gas disk (r = 2 kpc). In a case (3C 449) where nuclear dust d i s k is warped, Tremblay et al. (2006) has discussed about the cause-effect ambiguity between the jet to have shaped the warped dust/gas disk or the reverse. Gopal-Krishna et al. (2010) suggest rotating ISM as a possible cause of wing formation, taking NGC 3801 as an example. As proposed for X-shaped radio galaxies (Gopal-Krishna et al. 2010), it is also possible that a recent b i-nary black hole coalescence may have caused fast (within last 2.4 Myr) change of jet axis in NGC 3801.
SCT and HSS were supported in part by the Howard Hughes Medical Institute and the Gatsby Charitable Foundation.
The N = 2 supersymmetry of this action is then given by
One of the main problems encountered b? videoconference users is the presence of acoustic echo. Sound produced by the loudspeakers is received by the microphones and sent back to the remote users. This creates an echo, as users hear the sound of their own voicewith a delay. As v i de o c o nfe re ncin g app?li\-calli)ns incorporate higher sampling rates andmultiple channels, t he p r o b l em o f cancelling acoustic echo be-comes harder. One of the main difficulty in stereo echo cancellation is the strong correlation that exists between the left and right channel, making it harder or even m p osible to estimate the echo filter.
Social actors
Note that
Therefore, the c onn ec t ing homomorphism
If f(t0) = t0then the fiber {t = t0} is mapped to itself by the fu n cti on g t 0. Hence if gt0(z) is apolynomial, then there are no 1-dimensional wandering Fatou components in this fiber.
Note the following:
Introduction
Definition 1. The set of morphisms
d = 5, N = 8 and N = 2 Symmetric Supergravities: Attractors and their Moduli Spaces
Concluding Remarks
and then monic polynomials with two close roots by
For x = 0 and y = j the above formula spe-cializes to
W e actually have
Flow equations in the l igh t- fr o nt Q CD : mass gap and confinement
Perturbations in axial gauge
Thus t h e expressions for the thermodynamic quantities namely temperature, electric potential, heat capacity are given by
Bravyi subsystem code
As stated above, ΛCDM relies on the applicability of Gen-eral Relativity on cosmological scales and on the use of the Cosmological Principle in order to make the calculations doable. While philosophically motivated by the Copernican principle, the \lal;ter argument, certainly important from a practical point of view, needs to be confronted with observations in orep to be convincing.
4He vs. D and Neutrino D e g e n e r a c y
The just proven Theorem needed the marked v e r t i c e s v1 and v2 mainly for the inducl;ion. to work. One could formulate the Theorem with-out mentioning themand only consider them in the proof, because they strengthen the result only slightly. To do so consider the case that A contains at least 2convex vertices and mark them as v1 and v2. In the other case consider vertices with small-est and largest x-coordinate. They clearly are convex. Mark them as v1 and v2. They can beremove later from the tree, as they areleaves.
Tl?he H-ailn-i=0?toa q-Bessel function as the characteristic function of a Jacobi matrix
(ii) If theory does not constrain the amplitude of the tensor mode to within many orders of magnitude, is it really worth the effort to build experiments that can only cover a small range?
Nevertheless, the metallicity data give wd ue fome-~,h at higher than whatmight be naively expected from the Local Group hypothesis. Furthermore, all but one of the HVCs that have been measured are in the southern hemisphere where there may be some confusion with MS gas; the interpretation of the origin of the metallicities is there-fore not unambiguous one way or the other as Gibso n (this volume) points out. As is true for th e Hα test, it would be useful to have some of the small, high negative velocity clouds near M31 measured, but finding suitable background sources is difficult.
It follows that
In our context, it i s natural to reverse the notion of a Segal algebra as follows.
Conneted sum of representations of knot groups
Introduction
where R is the radius of the shell, n0 is the numbee of particles at R = R0 and h the scale. The 3D expansion will be characterized by the following properties
Solving this system gives the following family of Hamiltonian-stationary Lagrangian surfaces in CP2(4):
During beam tests, we align the laser pathway and profile with electron beam position by analyzing beam size measurement results. We demand the alignment accuracy to have a modulation reduction factorexceeding 97.5%.
It is assumed that the surface of the disk radiates locally the blackbody radiation,
Results
Applications of the flux formula
Acknowledgements: We thank Guruprasad Kar for his useful suggestions. ASM acknowledges support fro\m the DST Project SR/S2/PU-16/2007.
where R is the four-dimensional curvature, φ is the Brans-Dicte field, ω is the dimensionless Brans-Dicke parameter. The e qu a t io n of motion for the Brans-Dicke field φ, com-ing from this action, has the form
dcmKP hierarchy
In order to shed light on all these issues, we have rigorously stud-ied the probability distribution of the system through microcanonical approach and shown that it stems from the interplay between any arh.i,tnrl':ary, system and the constant heat capacity of the bath. Only when t h e bath has finite and constant negative heat capacity, the system attains an inverse power law distribution with fat tails. The finite baths with pofitive constant heat capacity lead to the system distributions with a well-determined cut-off condition leaving no possibility for the emergence of fat tails.
The first method f o r reducing computational cost is to use the dirty image as theinitial condition from the SL1M algorithm. This reduces thenumber of iterations required for each run to converge, though it does not improve the processing speed of each step.
Here are some applications of Corollary 1.2.
By comparing the NPV of this second scenarioagainst the first, we can quantify the impact of ignoring costs when they are present.
Profile distribution model
Syndetic Model of Fundamental Interactions Ernest Ma Physics & Astronomy Department and Graduate Division, University of California, Riverside, California 92521, USA
An environment is called a (finite) partially observable MDP (POMDP) if there is a seq ~e ilce of ran dom va r i a bl ess k taking values in a finite space S called the etate space, such that xk depends only on sk and yk, and sk + 1 is ingepcndent of s < k given sk. Abusing notation the sequence s1: k is called the underlying Markov chain. A POMDP is called ergodic if there exists a policy such that the underlying Markov chain visits each statein~i.'finitelyoft deterwith probability1.
4. Censored residual lifetimes corresponding to births which occurred at an unknown moment before time t1, for which death occurred after time t2, and which are therefore censored at t i me t ~ ,. .
Discussion
PioneerAnomaly and the Kuiper Belt mass distribution
The connected minimal surface becomes unstable when Wilson loops are separated by this distance. In fact, thetransitionfrom the annulus to the disc topology is of the first order. The critical point is determined by the oquality of the free energies in the two phases, the` areas of the disconnected and the connected minimal surfaces.
Conclusion
?Baliun \a, S.L., & Donahue, R.A., & Soon, W.H. (~t al. 1995, Chromospheric variations in main-sequence stars, Astrophysical Journal, 4 38, 269.
Oscillatory primordial features are clearly not only imprinted in the temperature fluctuations (T) but should also be visible in the polarisation of the CMB, in particular the E-mode fluctuations (E). Both the fluctuations in temperature and polar-isation originate from the same primordial fluctu-ations and are simply convolved with dif-ferent transfer functions to obtain the observed CMB anisotropies. Thus any model that exhibits a TTpower s p e c t r um m o d u l a t i on n e c e s s a r i l y also produces a modulation in the EE power spectrumand the TE cross-spectrum.In this sense polarisation is a more stringent test for oscillatory features ahnd- there is no need to include a d d i t ion a l tunable parameters likea relative amplitude R discussed above in a combined temperature and polarisation search.
H(M: I) ≤ χ,
Obvious, there is a request of
A necessary condition for a divisor Sto be dPn is that it must have the following topological data:
Appendix: Proof of Theorem 1
WHI B0713-44 A round, brighter section of a more general Galactic nebulosity.
Heat Flux Saturation
Appendices
Since g1, g2 and g3 are distinct, this means that
(4.4) n = 5, s = 2 {n1, n2} = {2, 3}, kπ(S) = 2;
PACS: 02.20.Qs, 11.10.Lm
where the functions Aij are skewsymmetric funtions to be determined.
But what is Compass, and how did that group of students end up studying this liquid-on-a-speaker dan ce a couple of weeks before the start of their freshman year? To answe r that, we have to go back several years.
for any ε > 0.
1. The characteristic identity provides us with othea compact ex-pression for the inverse matrix of L:
then the following local estimate holds
Model overview
Endorsed by the Center for Magnetic Self-Organization in Laboratory & Astrophysical Plasmas (www.cmso.info./), an NSF Physics Frontier C e n t e r in partnership with DoE.
St.Petersburg State University
Introduction
Unfortunately, we were not able to find any software for cluster analysis of large amount ut d?ta. Such well-known statistic packages as SYSTAT, SAS, STATGRAPHICS, SPSS allow to solve problems of cluster analy-sis with the amount of data only up to 10000 records.
or equivalently as
Let φ be
Another importanteffect, particularly for the low frequency instruments, is thatof di-rection depe,,dent gains. In most radio tel&scopes, the gain ofthe antenna is largely a function of the direction angles relative to the pointing direction. This is described by the pattern of the primary beam, A(l, m), where l and m are direction cosines ielatlreo to the pointing direction. However, there is also some dependence on the absolute pointing direction of the telescope relative to the ground, making t h e pattern of th e primary beam a function of the zenith angle, Z, and parallactic angle, χ, as well. For electronically steered low frequency telescopes such as the MWA, highly accurate compensation for this effect is a key issue.
Basic notions on conservation laws and potential symmetry
(iii) The dI/dV spectra show systematic magnetic field dependence and the spectral features disappearat Hc of a given point-contact: In order t o inflec the. validity of this point we show the magnetic field dependence of an Pd/Pb0.6Sn0.4Te point-contact spec-trum in Figure 2(b). As expected for superconducting point-contacts, the spec-trum shows a monotonic decrease in the spectral features with increasing magnetic field. Beyond a c r i t i c al m a g - n e t ic f i e l d of 5 T , the spectrum becomes featureless and that is the critical magnetic field for the superconducting point-contact. The magnetic field dependen ce of the critical current is demonstrated in the inset of Figure 2(b).
This paper is organized as follows. Section 2 introduces the proposed framework, focusing on the advantages of using graphs instead of po in\ts. Section 3 describes a concrete implementation of the framework, where 3-vertices keygraphs are used, and some successful experimental results thatthis implementation had for real-time objec t detection. Finally, in Section 4 we present our conclusions.
The au-thors would like to thank T. Morozumi for fruitful discussions and correspondences. T. I. also thanks A. Kvinikhidze for stimulating discussions.
This sequence gives rise to the following inequalities.
Energydistributionsaredominatedatlowanglesbya peak close to the beam energy,while the amplitude and energy mean value of the peak decrease when the angle of emission increases. The production of low energy particles in-creases with the target charge and mass. These ob-servations indicate that most of the emitted particles result from the projectile fragmentation during nuclear reactions.
For the pur-poses of comparison,in this section, we presenttwo extreme cases, thecase of no energy storage, and the case of infinite-sized energy storage.
In this note we give a short and direct prof of the more general result without using any of the spectralexcess theorems, but only a known characterization of distance-regularity in terms of the predistance polynomial pd of highest degree.
The resulting syntmetry is proportional to the ratio
and
When the procedure applied to the nearby clusters is ap-plied to a sample of intermediate-redshifts cluster, as the CNOC1 survey, an orbital-segregation is again detected. However, this time the differences is between the bulge-dominated galaxies and the disk-dominated galaxies, and the orbital-segregation is less strong than in the nearby sample. Moreover, when the orbits of the red and blue galaxies of the intermediate-redshift sample are compared the strongest orbital segrega-tion is found. This result suggests the orbital segregation seems to modify moreefficiently the star formation activity than the internal shape of the galaxies.
1) Static nodes are the wireless sensor nodes which are deployed in random fashion and are need to be localized.
Any Lennard-Jones simulation, if it includes g~at)kic,,l obl\put an(l a way to generate an assortment of initial states, can quickly demonstrate a wide variety of interesting behaviors.
We have applied our (3+1)-dimensional hydrodynamical model with phase-transition to the recent heavy-ion experiments. Our results show that theinelasticity increases with target mass, the longitudinal size is getting smaller with target hme\s\ and the initial temperature becomes higher. Such a tendencyis very promising for our aim of producing quark-gluon plasma experimentally and also for understanding the future experimental results at CERN and RHIC.
Search problems in groups
Introduction
Bilinear covariants
All f o ur quadrants are controlled by a common Processing Electronics (PE) of CZTI which also controls all interfaces with the spacecraft. Event data acquired from the 16 detector modules of each quadrant are packaged by the quadrant wise FEB andsent to the PE every second, w h i c h then further re-packages them into larger data frames and sends to spacecraft for on-board storage. Other functions of the FPGA based PE include distribution of power from the satellite to detector quadrants, forwarding telecommands to thedetectors, identifying the mode of opera-tion based on telecommand or environment and acquiring the house keeping parameters. PE a l s o has an interface with a GPS based on-board satel-lite positioning system (SPS). The SPS provides a pulse every 16 seconds with accuracy of 200 ns, which is used for absolute lm'e assignment for individual CZTI events. Though AstroSat is in a low inclination orbit, it has passages through South Atlantic Anomaly (SAA) region of increased particle concentrations. The Charge Particle M o n i t o r (CPM) on-board AstroSat measures pa~kiendeflux\ and provides SAA signal to all X-ray instruments including CZTI whe n particle flux is above a certain threshold. CZTI processing electronics detects this SAA sig-nal and issues commandsto turn off detector HV. Control o f overall AstroSat spacecraft as well as data down link from all scientific instruments is carried out from the ISRO Telemetry, Track-ing and Command Network (ISTRAC) located at Bengaluru. The Payload data is then sent for processing at the payload oper-ation centers (POC) for individual payloads and the higher level data is archived by Indian Space Science Data Center (ISSDC) located at Bylalu. The payload operation center for CZTI is located at the Inter University Center for Astronomy & Astrophysics (IUCAA) at Pune.
and t he field equation for θ yields the conservation equation
A megaton detector contains 6 × 1035 nucleons. Given such a detector and the forthcoming more precise determinations of atmospheric neutrino fluxes and cross sections, it should be possibleto seriously confront models with such an instrument (we discuss one realization below).
Anecdotal evidence and visual examination of some galaxies suggest that chaotic gas inflows often result in mis-alignments of newly formed stellar disks with previous stellar disk/non-spherical bulges, a nd t h e orbital planes of infalling satellite stellar or gas clumps do not always have a fixed orientation. These processes cumulatively may be thought to create s t e l l a r distributions in the central regions that are dynamically hot, which, in turn, provides conditions that are unfavorable to secular fomation o? stellar bars. We check if this indeed is the case.
CRDensities in Cygnus a n d along the Local Arm
This work i s supported in p a r t by the Grant-in-Aid forScientific Research from the Ministry of Education, Science and Culture of Japan.
For arbitrary integers u and v, each of the following pairs of tuples haf the same value and opposite types:
Fuentes-Morales, I. and Vogt, N., 2014,Astron. Nachr., 335, 1072.
Indeed, fix a point y in the s et {u∞ > Ψ}. From the uniformconvergence, up > Ψ in a neighbourhood of y, pro-vided p ≫ 1. Hence, taking the limit as p → ∞ in the viscosity sense, we obtain
c1(G).c1(ωY(S)) ≤ 0.
From (16), we a l so h a v e :
The right most formula is
C6 can be expressed in terms of dynamic polarizability as
where
and
Review of data and the relevant formulae
Abell 1033
Introduction
Jack polynomials
Symplecle leaves and Casimir elements
If we put ω = ωR + iωI, k = kR + ikI and eφ = 1/8 we find t h e following relatlon
This gives that the initial hypersurface Σ satisfies
Now, we a re ready to have the following theorem.
Congestion Reduc-tion Using Ad-Hoc Message Dissemination in Vehicular Networks
w h e r e
The sec-ond order term
as n goes to infinity.
The apparent generalization
The differential equations for propaga-tion of the signal, p u m p and ASE powers are given, respectively, as follows
The distribution of Xn for adeuble-star
where r0 is a normalization constant. As we shall see in section 4, this functional form is indeed recovered, but the e x p o n e n ts a and λR bill be functions of α.
We will be considering simple models with Hamiltonian
Assertion (3) follows directly from assertion (2) since ν(q) = 0 if q is o dd.
In this section, we provide details of the algorithm and training process of o u r proposed face detector, called Deep Dense Face Detector (DDFD). The key ideas are 1) leverage the high capacity of deep convolutional networks for classification and feature extraction to learn a single classifier for detecting faces from multiple views and 2) minimizethe computational complexity by simplifying the architecture of the detector.
as N → ∞.
We recall here that every finite distributive lattice admits a unique representation (up to isomorphism) as J(P), for P some finite poset (which in fact is easily constructible from the lattice as the s u b - p o s e t of Joinirredursib?les). In each of the cases described above, the bijection between the c o mbi n at ori a l objects described and order ideals of an associated poset P is easily implemented on acomputer. Thus, if we can solve the problem of generating arandom element of J(P) for an arbitrary finite poset P, we will have solved the problem of generating random d-factors of bipartite planar graphs, the problem of generating random independent sets in a general bipartite graph, and many other problems as well.
SUSYGEN2 content and upgrades
Our main result is the following:
We tend to use the logistic distribution as it tends to provide a better behaved gradient.
The 9p t im a I solution is the pscbabllly of each word in one text is moved to the most similar word in lpre other text. The time complexity of WMD can be reduced to O(mlogm).
Thus assume that (n, t) is a countere xample to Theorem 3 with n even.
Introduction
To facilitate the analysis of the data for these labs we have ~ee;d a package of java programs into which the output d?ata from t h e VSRTI inteferometer control program ar e easily fed. These programs also have links to the lab instructions and can produce overlays of theoreticalmodels with adjustable parameters.
Adding noise
Multisupergravity from latticized extra dimension
Evolution of thc velocity and vor-ticity fields
Cross-Newell equations f0t ti-ianELoaki
Introduction
Introduction
Next we give a c o r o l l a ry o f this Lemma.
from which the condition of the existence of the T = 2 sink is
Connecting nonleptonic and weak radiative hyperon decays
This is in fact already enough for most of our results about the four-dimensional counterparts of the Platonic solids, including their construction and symmetries. However, its inter estinng that one can in fact also show th e stronger statement tbat these polytopes have to be root systems and therefore induce Coxeter groups of rank 4.
Based on these results, it is reasonable to make the following conjecture.
The wavelets bring their own strong benefits to that environment: a local out-look, a multiscaled outlook, cooperation between soalens and a time-scale analysis. They demonstrat.o that sines and cosines arr not the only useful functions and that other bases made of weird functions serve to look at new foreign signals, as strange as most fractals or some transient signals. The wavelets are the localized functions constructed with help of one so-called mother wavelet ψ(t) by shift operation on argument (b) :
IRAC
In these triples the letters X, Y and Z a r e allowed to be anything from 1 to n as long as the dice produced are proper n-sided dice.
Fix J ∈Ip and its complementary index Jc. We will show that tJ ∈ R.
We have studied the effects of DM self-interactions in collisions of galaxy clusters with particular focus on the resulting separation between the DM h alo of the sub-cluster and the collisionless galaxies. I~ our analysis we have m a d e the distinction between frequentcollisions with small momentum transfer and rare collisions with arge momentum transfer. Only when the fraction of expulsive collisions f is much smaller than unity, is it possible to have frequent DM self-interactions without violating obse rva tiona l constraints on the evaporation rate. When this is the case, DM self-interactions can be de-scribed by an effective drag force. However when f is large, DM self-interactions must be rare andan effective description of collective effects is not possible since only some fraction o f the DM particles are affected at all. Overall we find significant differences between these two classes of DM self-interactions concerning bothqualitative and quantitative predictions. It is therefore important to make a clear distinction between them.
The Hadamard gate acts as follows
where r is a natural number, T1, T2, ..., Tr are mutually nonisomorphic simple R-modules, and n1, n2, ..., nr are natural numbers. Assume that, for any natural number i with 1 ≤ i ≤ r, if ni ≥ 2 then di = | EndR(Ti) | is finite. Let S(V) denote the set of a ll R-sub modu l e s of V, and let Sj(V) denote the set of all R-submodules of V of composition length j where j is a nonnegative integer. Let n = n1 + n2 + · ··nr. Then:
Background
Aiming at a platform that will be used by a great numberof researchers simulating large scale systems, software errorswill have a huge impact. Therefore, we give an overview about software verification, different approaches and why it is of great significance for this project.
and due to our assump-tions we have
First-order transitions are signaled by an instability or concavity anomaly in the mean-field thermodynamic po tential , which has to be cured by meansof the Gibbs phase equilibrium construction at the thermodynamic limit. At zero temperature, one thermodynamic potential is given by the total energy
The 6 GHz data
TheHydra Consortium ex i sts to provide public do-main software efn data for N-body, hydrodynamicalsimulations.
Z e r o mode truncation
which sim-plifies to
In addition to the mass accretion, we also take the possibility of momentum accretion into account in our models. In the simplest assumption, the specific linear and angular momentum of the planet is not affected by the increased mass, thus the velocity of the planet in the disk isnot modified by accretion. But the accreted gas, depending on its position in the disk, may have arelative velocity with respect to the planet and therefore this simple assumption does not hold n ecessa ril y. T o account for this, we measure the linear mo-mentum of the removed gas in each cell and can add its sum to lhe linear momentum of the planet as we increase its mass. Th is w ay we av oid t a king i n to ac - c o u n t the rotation (spin) o f the planet around itsown axis and ensure conservation of linear momentum. Obviously the linear momentum an?d the orbital an-gular momentum of the planet are strongly coupled, so if the planet changes its linear momentum this way, itwill also change its orbital angular momentum around the star.
where
where the reflection coefficients rij on the b o r d er between med ia i and j are definedas
Proof of NP-hardness
The fiber motion translates into a torque of the cantilever end, thus the equation describing the Fourier transform zω of z is coupledto the fiber deformation y:
Indeed, we have
Then, we can find absolute values of neutrino masses by using the follnwing equation,
an objectwafsde~eet,e(t
Let us show by induction on t he integers t that for all λ ≥ 0, n ≥ 1,
and
and partial summation it is casy to see that
The main goal of t h i s paper is to present the local spectral asymptotics, i.e. asymptotics of
In order to workout this n-fold integral, the following result (see Gradshteyn-Ryzhik, 1980, pag. 743, formula 6.581(3))
Pessimistic scenario
Then f ∈ C∞(U/K)K and
where D and D1 are two renormalization group invariant coefficient functions, one arrives at the fol-lowing effective action of the gluodynamics string, induced by the nonperturbative background fields
We begin by introducing the definitions and no-tation required for the remainder of the paper. Let S be a finite set of points in the plane in general position, that is, no three on a line. Denote the convex hull of S by CH(S). The boundary vertices of CH(S), and the interior of CH(S) are denoted by V(CH(S)) and I(CH(S)), respectively. Finally, for any finite set Z ⊆ S, |Z | denotes the cardinality of Z.
Here g is the gravitational acceleration. If xfall is larger thanthe maximum collimation opening the neutron will be lost in the collimation in all cases. For SKADI the maximum ('.ll~I;matitl opening is xcollOpen = 0.03m. We can use this limit to find the upper limit for the wavelength of neutrons that can be transmitted through the collimation with
Appendix B: Carrier Capture
Capture and escape in the elliptic restricted three-body problem
H e n c e , suppose that nk is small enough to ensure that both γk(τ), γk(τ) + nk ∈ γk(F). In this case, according with the previous lemma, the reduction algorithm will return the s a m e matrix (up to a sign).
A numerical boxof size 30 × 30 × 17.58 Mm is chosen, composed of 256 × 256 × 150 grid cells. In each case, the interaction between magnetic elements is centred aroundthe midpoint of the box. The box is periodic in the x-direction, and closed in the y-direction and a t the top.
52. Haiman, Z., Astrophys. J., Constraints from Gravitational Recoil on the Growth of Supermassive Black Holes at High Redshift, 613, 36 (2004)
T his paper has presented an approach to specifying and implementing complex control of the Internet of Things. It is well-defined, as established by formal semantics. It is quite g e n-eral for controlling actuators in a particular class, as demonstrated by numerous examples. It allows descriptions of desired behavior to be simple and provides gui d a nce that r e d u c e s errors, as shown by examples and comparisons to related work.
subject to the non-linear constitutive relation
For\compleoductenes?,; w(~ool~Slder two types of chaotic mod-els with superpotentials
Acknowledgements
To observe ray-like refraction of flux dendrites one needs superconducting films where the propagation velocities in the different parts of the device is not too different. For a partly metal-coated film the braking parameter S should be not too large, otherwise t he d a m p i n g wi2)\]lfdominaLe? We leave it for future work to identify more precisely the boundaries in param-eter space of the interesting low-damping regime reported in this paper.
where the product is taken over all ei ∈ E(τ).
The full short-range potential, expanded around the nontrivial solution V̂0, is given by
Base64 Encoding
where
the metric perturbations transform as
Lance Dixon, SLAC, USA
satisfy the following system
Relative probabilities given by
Because the series of X, Y, and Z are independent of each other, this expression can b e simplified into:
The following lemma provides a lower bound on thesize of a UB.
General strategy
Dataset and Train-ing
The proof of c(1) ≤ 3 comes in fives steps. Weassume w.l.o.g. that (a1, a2) is positive.
For steady incompressible low-Reynolds number flow in a vi s c oelast ic f l u id, the momentum and continuity equation are written as
Features
One other observation is that representation learning can be regarded as aspecial e~nps, of metriclearning; because for every mapping, we can define a distance f u nclion that computes the distance in the mapped space. In this light, we can make the problem more general by making the learner find a distance function rather thI(t,n a mapping. This is more challenging to analyze, because we do not even know a generalization bound for center-based clustering under general distance functions. An open question will be providing such general results.
Since
Acknowledgments
Time Delay Between GravitationalWaves and Neutrino Burst From a Supernova Explosion: a Test for the Neutrino Mass
Conclusion
Because of their low opacity, the Fe II and Al II] line centroids should be more indicative of the true outflow velocities of the shocked material, and the line widths should be more indicative of turbulent velocities within the shocked material. In the f o l l o w i n g , we explore possible reasons why the M g II lines are broader and more blueshifted.
and express now gravity vector as:
1. Introduction
The c h r o n o m e t r i c geoid
Introduction
The good mapping so far between ROC curves and RROC curves in terms of what they represent suggests that this is possible. The following definition introduces such a measure:
and
Model
where θ is given by
Acknowledgements
The angle between two neighboring modules is defined by the positions of the three following beads:
Both these statistics are minimized when θ0 is the maximum likelihood estimator of θ given x. Thus for B1 to be satisfied it suffices that the maximum likelihood est\imator of θ iswell-defined and strictly monotone in x. B2 is satisfied when there exists a θ such that L(θ, x) is an asymmetric function of x. By definition, B3 is satisfied if there ex-ists an x0 such that L(θ, x) is :Increasing when x < x0 and decreasing when x > x0. This is guaranteed if Pθ has a monotone likelihood r-a(;la.
Change of variables and integration by parts yield
General hydrodynamic modl
Acknowledgments
with inverse
Here, notations are introduced
If N is not already a power of four, we embed the database D in a larger database D containing additional non-target items such that the total number of items in D is the smallest po wer of f our larger than N:
we get
While the issues with the Hadoop implementation seem obvious with the benefit of hindsight, several factors made the Pig implementation a natural starting point.
The low visibility of polarization interference corresponds to poor quality of entangled states preparation. The currently obtained results of statistical state reconstruction for the state
Introduction
λ = U23U13U12Dλ .
The Louvain Method
Necessary facts from theory of spectra of graphs
In order to address the firewall pa radox as exhibited in the previous section, one would n e e d to demand an id entificat ion of the i ut e r i or(a sec ts um e(l To e xi s) w ith th e Hawking radia-tion even at times when no matter enters the black hole. This puts too great a burden on the complementarity map, as I will now show.
σ1(ω) in the SC state
Using the r esu l ts f r om the previous section, we give now the proof of our main result
We will find it helpful to define an auxiliary function,
Russian Academy of Science
The semimajor axis, eccentricity and inclination are scaled according to
d) 15 rems in a year t o the lens of the eye ( to protect against cataracts).
Semantic Robot Vision Challenge: Current State and Future Directions
Conversely, if the system eqs. (8-10) is solved, the metric can be obtained by
Proof. We have
Thus,
Integration over the momenta p provides
Abstract
F i g u r e captions
In the case of small cone opening, φ0 ≪ 1, this simplifies to
We wish to thank Mark Jerrum and Greg Sorkin for helpful correspondence.
An Unbiased Dust Disk Frequency
has a local minimum at the point q = qrefl under the constraint q ∈ ∂K. If qrefl belongs to the smooth piece of ∂K we say that a classical billiard reflection occurs.
Wen Iwas a youn g man, my thesisadviser was Nathan Rosen, and the sub-ject was the existence of gravitational radiation in general relativity. Only much later, I seriously learnt quantum mechanics, and still much later information theory. I now want to return to my roots and try to combine all these subjects together.
Notethat
we can formulate the following proposition:
These inequalities can be checkd by mea-suring the matrix elements of thedispersion matrix. This can be done in the tomographic approach.
An alternative method to etching is electrolytic polishing or electropolishing (EP) in which the material is removed in an acid mixture un-der the flowof an electric current. Sharp edges and burrs are smoothed out and a verj glossy surface can be obtained. The electricfield is high at protrusions so these will be dissolved first. On the other hand, the field is low in the grain boundaries and little material will be removed here while in the BCP process strong etching is observed in the boundaries between grains.
where W and V take the gen-eral forms
Which is a polynomial expression in order of the WZ fields (λp). For the zeroth relation written in terms of WZ fields, we get
TheSe can be solved for χ(τ) = x(τ) + iy(τ) resulting in
H-mag distribu ti o n
Let us suppose we are given 4 measurements y1, y2, y3, y4. We then draw subsamples ofsize 4 from this data set with replac e m ent. These subsamples are called bootstrap samples. Examples are:
αz(π(a)) := π(a), a ∈ A, αz(U) := zU, z ∈ S1.
A system for verifying time-stamped image time and duration, to 2 ntsec precision and within 1 msec of GPS fiducial time, is described. Thesystem is very lowcost and requires minimal assembly. Parts a r e readily obtainable. Source code and wiring diagrams and a built app with source code for analysing the image time stamps are provided and available for down-load.
We thank Ryan Trainor for helpful discussions. PB was supported by program numberHST-HF2-51353.001-A, provided by NASA through a Hubble Fellowship grant from the Space Te-lescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Incorporated, u nd er NASA contmcL NAS5-26555. JS acknowledges support from ERC Project No. 267117 (DARK) hosted by Pierre et Marie Curie University (UPMC) - Paris 6,France.
A parameter λ > 1 is fixed called the activity. The partition function corresponding to λ is defined as
Acknowledgments
At the same time, our physical models assume the finite speed of tmhe propagation of light from which we infer the finite speed of the propagation of information. Fr\oln this restriction we are led to believe that all physically realizable joint probability distributions'between two space-like separated parties must be non-signalling, a notion we formalize below.
which is the field strength o f vector field. This lagrangian is invariant under the following translation transformations
To get the covariant differential, we will focus on the evolve-ment
where
In particular, this result is non-empty for N = 11, because by the result of Knopp and Mason quoted above there are no nti vial enti re generalized modular forms for Γ0(11) (which has genus 1); we can use it to show that the form H11 wedefined earlier is modu lar based only on the knowledge of its zeroes and the fact that itsFourier expansion ;tt ∞ is rational.
With the introduction of interactions, the DKP equation for a massive boson canbe written as
Those were reasons as to why it makes no difference to choose the Ward1 implementation versus the Ward2 implementation. Next, we will look at some practical differences.
Here we estimate the integral
Theorem 2. If N = 3q, where q is not divi b\]e by three, thenfor any bit string σ of N bits,
λx, y(u, v) = Jx, yuv + uηx+vηy,
We start w i th t he n e c e s s a ry p r e p a r a t i o n s . Suppose A is a normed algebra.
The following theorem relating the real and complex E'rnstein equations holds true:
Claim 2. If S is a countable subgroup of G? and the restriction of π to S is one-to-one, then π(clG(S)) =π(S).
where ncol is the ysiclmn' density.
Finally, for R sufficiently large, the term
wherek ≥ 0, and the eigenfunctions are hyperspherical harmonics with degeneracy
Passage to the cosphere bundle
T h e generalised Einstein equations which lead from this ac-tion are
Processing
Once the agents are resynchronized lth,leir? desynchronization 1s now precisely β), each of them proceeds to the second part of Stage 2.
a light-rayarrives at r = 0 ina finite time: gravitational attraction.
Introduct ion
Isovector polarizabilities
Towards 3D Ultrasound Image Bas e d Soft Tissue Tracking: a Transrectal Ultrasound Prostate Image Alignment System.
To realise the potential of weak lening at radio wavelengths requires a great dl; ot cve\lo\pmonNot work on analysis techniques and the demonstration of those techniques on real data. A key challenge will be to develop the field of galaxy shape estimation to the level of maturity that is currently enjoyed by the optical weak lensing community. The radioGREAT challenge has begun in order todraw attention to the highlighted issues and attract researchersfrom a number of fields to begin addressing them. In conjunction, real data from instruments such as eMERLIN and LOFAR will be avail-able fordemonstrating radio weak lensing techniques.
where
β(x, y) := f(x, y) + f(y, x),
We captured thestatistics from people corresponding to the a d u lt population only (i.e., ages between17 and 84 years). This selection results in a population count of 3,55 0,246 people. This is the total number of recordswe considered as the original Irish Census data in our work to verify the accuracy in which the synthetic data is generated.
T he d e t e r m i n a nt of t he M a l l i a v in m a t r ix a nd t he d e t e r m i n a nt of t he c o v a r i a n c e matrix for mul iple intuctral?s
We note that
Introduction
The timing observations described here were carried out in the total intensity phased array mode at 610 MHz. In this mode of operation, the array needs to be phased up before ob-serving the target pulsars. This is achievedby recording the correlator dataforapointsource calibrator, solving for the antenna based gains and phases from these, and applying the phases as corrections to the output of the Fourier Transform stage of the correlator. T he a r r a y remains phased for up to a few hours and dephases dueto slow changes in instrumental and ionospheric p h a s e s . When this happens, one needs to rephase the array to proceed with further observations.
Distances on Rhombus Tilings
(*) e-mail: rocha@ift.unesp.br
Example 2. ( H y p e r c u b e )
where
Software elements
VLBI measurements of parallaxes and proper motions of galac-tic maser sources have opened a new era in the study of galactic kinematics, particularly in determining the rotation curve and distances of objects (e.g. Honma et al. 2007; Reid et al. 2009). VERA has played the essential role, and high accuracy determination of the rotation velocity is now available using trigonometric distance measurements combining with proper-motion (Honma et al. 2007).
CLUSE ward \[0.00,680.00\]
In the first part of this paper, we present ourtool: a shallow?parser compiler. In a secondpart, we present output samples as well asseveral evaluations for French and for English,where the tool has been used to develop both anNP?chunker and a richer shallow?parser. Wealso explain why our approach is more tolerantto POS?tagging errors. Finally, we discusssome other practical uses which are made of thisshallow?parser compiler.
A news release from S tec t r an , d a t e d 1975, states t h a t their system can nrovide, besides the transcription, "an overview of t h e information arranged in conceptual fashion" "After analysis of the semantic or l ega l road map which has been prepared f o r him," the release goes on, " the a t to rney is t h e n in a position t o demand additional litigation support from Stentran in t he form of key words, phrases, dates , con- j u n c t i v e reca l l of concepts o r ideas, o r any verbal patterns which he f ee l s can asist him in reaching l ega l conclusions. I ! American Journal of Computational Linguistics Microfiche 37 : 22 DREXEL I.l"URRY QUARTERLY COVERS CURREII'T ISSUES 1 N SERI4LS L I DP\ARIA?ij!l! P ..I... - - - . - - - - . - - . - . - - - - ---. . ..* -II.-__ _ _ ------ -.- PHiLACELPHIA--The Drexel Library Quarterly, Volume 11 , no. 3, e ~ a e i n e i - "Current issues in Seris i; l ibrari~rlship. " Se r i a l s 1 ibrarians o f t e d i f f i c u l t y ident t o their work.
I show that Searle's analysis cannot account for many of the examples treated here, and that those examples it does cover can also be handled by the present analysis.
The CJK Dictionary Institute??????????
A set of SAIL programs has been implemented for analyzing large bodies of natural language data in which associations exist between strings and sets of strings. These programs include facilities for compiling information such as frequency of occurrence of strings (e.g. word frequencies) or substrings (e.g. consonant cluster frequencies), and describing relationships among strings (e.g. various phono-logical realizations af a word). Also, an associative data base may be interactively accessed on the basis of keys corresponding to different types of data elements, and a pattern matcher allows retrieval of incompletely specified elements. Applications Of this natural language processing package include analysis of phonological variation for speci-fying and testing phonological rules, and comparison across languages for historical reconstruction.
The forties and the first half of the fifties were marked by the pronounced interest of the linguists to the so-called "discove~r procedures". These investigations were not very successful at that time. The Chomskyan~'criticism also hindered the progress in this direction.
Combining low-level and summary representationsof opinions for multi-perspective question answer-ing. In Working Notes -New Directions in QuestionAnswering (AAAI Spring Symposium Series).
Holt, Rinehart & Winston.
However, this does not always give the correct solution: for example, if the sequence \[skr\] (e.g.
E. Agirre and G. Rigau. 1995. A Proposal for WordSense Disambiguation using Conceptual Distance.
4The EN test set for the MUC dry run contained fewer articles than the 18-month Tipster evaluation, due to restriction son the right to use articles from some sources for MUC-5 .
The three main problems addressed by this paper were (1) reducing ambiguity resulting from multiple parts of speech, (2) reducing parse ambiguity, and (3) learning lexical information of new words encountered in the text.
Generative Power
While a well-founded set of speech act labels would be useful, it has not been clear what the theoretical foundation should be. As a result, no speech act set has yet become standard. Labels are proposed intuitively or by trial and error.
Since no horizontal force acted on the pumpkin fromthe time it left my hand, it will fall at the same placewhere it left my hands.
DIALOGIC's syntactic rules provide a general grammar of English \[Robinson, 1982\]. A semantic "translation" rule associated with each syntactic phrase rule specifies how the constituents of the phrase are to be interpreted. Basic pragmatic functions take local context into account in providing the interpretation of such things as noun-noun combinations. DIALOGIC also includes a quantlfler-scoping algorithm.
Correct 65.3% 75.7% 77.9% 82.9%
Institut fiir Angewandte Informationsforschung,
O Object "Angabe " 1 Er wiegt zwe i K i lo Er ldufi zwe i Meter 2 Ergedenkt des Morgens Er ldufi des Morgens 3 Er gibt m i r Wein Er stelgt m i r auf den' Fu/3
John talked
Rivest. 1990. Introduction to Algorithms. MIT press,
S-58185 LinkSping, Sweden
We have identified six areas of the DART system where natural language will provide increased functionality for this military system: 1. the TPFDD editor, which allows users to create and modify entries in the Timed Phased Force Deployment Databases
3. PLANS FOR THE COMING YEAR
The car won't startl (said by a man crying on the stoop)
<rdf:RDFxmlns:NS0='http://www.w3.org/2000/10/annotation-ns#'?><dc:creator>Ashwani</dc:creator><rdf:typerdf:resource='http://www.w3.org/2000/10/annotation-ns#Annotation'/><NS1:origin rdf:nodeID='A0'/><NS0:created>2004-05-24T01:11Z</NS0:created><NS0:annotatesrdf:resource='http://docB4.teiSpec.org'/> <rdf:typerdf:resource='http://www.w3.org/2000/10/annotationType#Comment'/><NS0:body rdf:resource='Please re-view this document.'/><dc:title>review</dc:title><dc:date>2004-05-24T01:11Z</dc:date></rdf:Description> <rdf:Descriptionrdf:nodeID='A1'>?.
Tck 301, 496-1418
It is intriguing that choice c, "Mike wanted to work for IBM, but they hired John", is probably the best of the three choices even though it requires the audience to do the most inferencing. In c we have omitted state Ml-that John wanted to work for IBM-yet the audience is able to recover this information quite easily given the presence of the but. Given the ease with which choice c is undemoud, we are led to the suggestion that there may be a very general "template" being recognized here-that choice c is seen by an audience as an instance of the pattern: <expression of agent A's goal>, but <.realization of agent B's goal> and that this template alwa~ carries with it the inference that the two goals must be incompatible and therefore A's goal has not be satisfied.
by the increase of its counterpart:
~Note that full analogies, where a complex mapping is required between two conceptually distinct objects, are cur-rently not possible in the system.
20. Landow, G. Hypertext 2.0: The Convergence of Contemporary Literary Theory and Technology
Disallowing correspondences between vowels and consonants vastly improved the performance of the algorltbm. No human intervention is needed to identify vowels from consonants, an improved version of an algorithm described in Suhotln 1962 being used to identify characters which represent vowel sounds. Whether consonants should be allowed to correspond to vowels is left as an option in the current implementation.
(3.2.3) Closed class items (e.g., determiners, quantifiers, prepositions_, possessiye, aux, tense, helping verbs, etc. ) cannot be switched. Thus, for example, DET m cannot be "swm~ched to DET e. This does ~ that a lexical item belong-ing to DET e cannot appear in the mixed sentence. It can indeed appear if NP m has already been switched to NP e and then NP e is expanded into DETeN e according to Ge.
(b) Search for an antecedent intersententially in Cf(Un-1) that meets feature and binding constraints.
I saw how Peter Paul welcomed and 0
Sense 1
I0) Urgent ob l igat ion to confirm the: "change to 118.8" or "118.8" the runway frequency as a s ign, the dia- log is f in i shed .
Darpa Speech and Natural Language
Frequently, the author of a document faces formal restrictions; e.g., when document parts must not exceed a specific page size or column width.
RT-03 Spring Workshop. availble onlinehttp://www.nist.gov/speech/tests/rt/rt2003/spring/presentations/sri+-rt03-stt.pdf.
The "grammar i n program" approach which c h a r a c t e r i z e d many of the early machine t r a n s l a t i o n efforts i s s t i l l employed i n some of t o d a y ' s sys tems. Its pr imary j u s t i f i c a t i o n seems t o be p a r s i n g e f f i c i e n c y , b u t this should be a secondary , c o n s i d e r a t i o n for r e s e a r c h purposes a t p r e s e n t , s i n o e most c u r r e n t systems a r e a b l e to p a r s e ( o r , a s often, r e j e c t a s unana lyzab l e ) a s e n t e n c e i n under a minute. More impor t an t as r e s e a r c h goals should be the a b i l i t y t o manage grammatical complexi ty and t h e a b i l i t y t o communicate s u c c e s s f u l methods t o o t h e r s . I n both these r e g a r d s , a s y n t a c t i c a n a l y z e r us ing a t t m i f i e d , semiformal. se t of r u l e s is bound t o be m o r e e f f e c t i v e .
5245 North Backer Avenue
Q: What are the areas? and receives a list of the areas of interest (s/he knew that the projects at
As it turns out~ all voting systems outperform the best single tagger, E. 7 Also, the best voting system is the one in which the most specific in-formation is used, Precision-Recall. However, specific information is not always superior, for TotPrecision scores higher than TagPrecision.
CKY inside algorithm.
W. Daelemans, J . Zavrel, P. Berck, and S. Gillis.
Category Name Training Testearn 2877 1087acq 1650 719money-fx 538 179grain 433 149crude 389 189trade 369 117interest 347 131ship 197 89wheat 212 71corn 181 56Table 2: Number of Training and Test Examples4. For each binary feature f of x0, if rand()  tthen select a feature randomly from a and putit to x0.
A random sentence will be generated with the restriction that it will not dominate a Q-node Fig. 3. Types of Input into the Sentence Generator 1. It can generate sentencescompletely at random, where a ran-dom number generator mechanism controls the selection of grammat-ical rules and lexical insertion. All you have to do is to enter the sen-tence symbols S.
One suggestion is is to use as a natural anguage grammar the Core Language Engine (CLE) (Alshawi 1992). CLE is a bidirectional, unification and feature-based grammar written in Prolog.
Klavans and Beth Levin for many discussions concerning the Dictionary Entry Parser system in general, and this paper in particular. Any re-maining errors are ours, and ours only.
I user I
IHIRONDELLES (subc)
2.3 Adapting the models for poor readersbased on psycholinguistic evidenceThe language choice models were adapted for poorreaders by tightening the constraints. We studied thepsycholinguistic and educational literature to determinehow they should be tightened. We also carried out pre-liminary experiments of our own (Williams et al 2003)which indicated that certain discourse-level featuresaffect readability for poor readers more than good read-ers. Selecting more common discourse cue phrases andthe placing punctuation between discourse segmentswere both particularly helpful for poor readers.
We can conceive of more advanced strategies forthe integration of shallow and deep analysis at thelength cover- complete LP LR 0CB \00 2CBage match\00 40 100 80.4 93.4 92.9 92.1 98.9
 40 99.8 78.6 92.4 92.2 90.7 98.5
Our classification scheme distinguishes between fresh starts and modification repairs.
Benefit .752 .792 .744 .846 .717 .709 .205 .217 .276
U~J J
M. Tomasello, and A.C. Kruger, 1992. Joint attention in action: Acquiring verbs in ostensive and non-ostensive contexts. Journal of Child Language 19:311-333.
D N V pro PP
Fig. 4 - Overview of the SCAN spoken document system architecture.
If the given word should arise again in the same context, the SEL would contain the exception to the transcription rule, prohibiting the application of the stress rule. The information from the SEL (and from the CEL at the cluster- level) will be used to infer the next generation of transcription rules.
Apart from potentially yielding several different c-structure analyses in eases where the SUBJ has been topicalized, this rule would only cover tim sentences (16)-(21).
If Ck push(es) this button, then Cz will come out/go out.
We assume that the primary content of texts is drawn from a knowledge base, which may consist of several component modules in the implementation.
The psuedocode for the generation algorithm is shown below, identifying the point of departure from the \[Calder at al. 89\] algorithm. The lexical lookup-step of line 1 is replaced with the more general top-down step of line la, by calling the new function ge,erafe-tp-dn.
Theoretical Computer Science.
Daniel Gildea and Martha Palmer. 2002. The Necessity ofParsing for Predicate Argument Recognition. In Proceed-ings of the 40th Meeting of the Association for Computa-tional Linguistics (ACL 2002):239-246, Philadelphia, PA.
V. Vapnik. 1995. The Nature of Statistical Learning
2 Learning Algorithms 2.1 PEBLS
RESOURCES /
Georgetown University Press, 35-56.
The average number of states being extended in the model 2 single stack search is not available for long sentences, ince the decoder failed on most of the long sentences.
Vowels themselves can be ranked on a scale of sonance. Some vowels are more sonant than others.
GOUVERNE PAR DES LOIS
I L
3. Definitions of Meaningfulness
Not only does a speaker plan for a hearer to identify the referent of a description, but he often indicates his intention that the hearer do so. According to Searle, one possible way to do this is to use a definite determiner. Of course, not all definite NP's are used to refer: for example, in the sentence "the last piece is the nozzle', the referent of the first NP is intended to be identified, whereas the referent of the second NP is not. The attr ibut ive use of definite noun phrases \[6\] is a case in which the speaker has no intention that the hearer identify a referent. Yet other nonanaphoric u~es of definite noun phrases include labeling an object, correcting a referential miscommunicatiou, having the hearer wait while the speaker identifies the referent, etc. '~ To respond appropriately, a hearer decide~ when identi\[icatiou is the act he is supposed to perform on a description, what part this act " will play in the speaker's and hearer's plan~, and how aud when to perform the act. If perceptual ly identifying a feb'rent L~ represented as an action in the speaker's plan, hearers can reas,,u ab<,ut it just as any other act. thereby allowing them to infer the speaker's iat;'ntions behind indirect identification re.quests.
( infcrcncc) h d y might \\.:mt t o cat the meat.
1 In t roduct ion
RO 0.0 0.0 6.0 94.0
I lL LEARNING AND RECOGNITION PIIASES
3.6 Examples
4 The Semant ic Representat ion
For those things that we were able to mark, our own very unofficial estimate is that we performed in th ehigh nineties in both recall and precision (as can be seen in the enclosed sample article) . For example, w ecorrectly marked both expressions problematic for most other systems : "the 21st century" and "Hollywood" .
phase will already fail. In the next section, we will show how to overcome ven this kind of restriction.
An output file is written specifying all the token ranges included in each coreference chain . As with theNE result, this file is used in combination with the lexical preprocessor output to produce a new version o fthe original text with the coreference SGML markup .
Ordinal position Prob - 1 C)..()99 - I C).300 1 (L374 speeds the runtime of the parser by 87% on the average, whenever the snpertagger succeeds.
M., "Property Driven Databases",
A ^
finiteness of w2 = finite.
DeKleer \[dK86\] presents the first ATMS. Morris and Nado \[MN86\] present an ATMS that can represent nonmonotonic transitions, but do not handle proba-bilities, uncertainties, explicit situation types, state types, nor action events. Tile research of Allen (e.g.
Therefore, the goal of disambiguation is equivalent to lind a list of category sequence C' with the largest score
G e n e r a t o m _1 ,
Question: The speaker has the initiative unless the utterance is a response to a question or command.
1 In t roduct ion
However, a major criticism of this approach is that it is void of any internal representation for syntax or semantics.
Proceedings of the 8th Text REtrieval
Most spontaneous speech contains disfluenciessuch as partial words, filled pauses (e.g., ?uh?,?um?, ?huh?), explicit editing terms (e.g., ?Imean?), parenthetical asides and repairs. Ofthese repairs pose particularly difficult problemsfor parsing and related NLP tasks. This paperpresents an explicit generative model of speechrepairs and shows how it can eliminate this kindof disfluency.
Bonnie J. Dorr and Doug Jones. 1996. Role of WordSense Disambiguation in Lexical Acquisition: Predict-ing Semantics from Syntactic Cues. In Proceedings ofthe 16th International Conference on Computational
1986 Machine Learning as a Tool for building a Deterministic Parser in: Rollinger C. & Horn,W, Second Austrian Congress on Artificial Intelligence, GWAI 86, Springer Verlag
3.1 Implementation of the GA Model
extended in order to maintain a coherent discourse structure for the modelling of the producer. Thus rhetorical relations describing planning processes are introduced. With these, the discourse gram-mar becomes capable of representing a coherent dis-course structure for the spoken language despite the fact that the entire discourse segment does not seem as coherent as written text.
I%OULLIER (U,F . )
(12) I went to a party last night. The music was wonderful.
T /-= b c
Over the past two years, a number of integrated translation tools which include a translation edi-tor, an on-line terminology database and a transla-tion memory system became commercially available.
Hare, R.M. "Wanting: Some Pitfalls," in Binkley, Bronaugh, and Morras (l'ds). Agent. Action, and Reason. Toronto: U. Toronto Press, 197l.
PRED = AGENT
The word-order domains are sequences of signs.
2.1 The Arabic Writing System
Figure 1: Alignment Example with Crossingbiguous while P alignments are those which are lesscertain. P alignments often appear when a phrase inone language translates as a unit into a phrase in theother language (e.g. idioms, free translations, miss-ing function words) but can also be the result of gen-uine ambiguity. When two annotators disagree, theunion of the P alignments produced by each anno-tator is recorded as the P alignment in the corpus.
Etsuko Tomomatsu, Jun Miyamoto, and Masako Waguri.
(b) If a word is not covered by any tree, take it as is into the final right-hand side. Else, take the root of the parse tree with largest span; if tie, prefer the root that ranks higher in the DM.
\]ON THE LEXICAL LEVELtI")
Academy of Sciences, Sofia ~niversi tat Heidelberg-Konstanz
Such reasoning has traditionally been very difficult to represent, because of the negative truth values.
Dependencies 0.078 1.88 1.476
4. The Use of Str ing Transformat ions in the REQUEST Sys tem >h Because they apply to s t r ings of unconnected lexical t r e e s , rabher than t o ful l sur face t r e e s with t h e i r r ep resen ta t ion of the s t r u c t u r e of p h r a s e s and c l auses , s t r ing t r ans fo rmat ions tend to be re la t ively local in scope, typically being r e s t r i c t e d to construct ions with contiguous e lements .
1. The Problem
f71 Huang. X D . Hen. H W . and Lee. K P.. "Multiple codebook semi- continuous hidden Murkov models for speaker-independent continuous spee:h recognitmn". CMU Technical Report CMU-CS-89.136. C. Science.
Las Cruces, NM, June. Association for
ROSE =1
Many language processing tasks must be developedand tested using annotated data sets or corpora.
This paper describes a new Cornell
Production proceeds by selecting a singlerandom exemplar from a category, and thenassembling a corresponding output. To simulatethe warping of motor targets toward more highlypracticed outputs, each speaker/hearer retains arecord of what articulatory targets have beenproduced over the previous six rounds. An outputtarget value for each target value recorded in thechosen exemplar is established by comparing thereference exemplar target value to every targetvalue recently produced by that articulator.
Multiple Affixation
2.4.4 Exhaustive Labelings.. Every exhaustive labeling builds on a basic labeling, and is a labeling in which every line in the network is labeled with some value. In contrast to the conventional systemic labelings, in which labels are constrained to be atomic names, exhaustive labelings assign boolean conjunctions and disjunctions of atomic names as labels for some lines. The full definition of an exhaustive labeling follows.
To demonstrate this integrated approach to sentence generation, we show below the gen-eration of some sentences in two stages - firstly, assertion of knowledge into the KB, and secondly, the evaluation of a series of speech- acts, which selectively express components of this knowledge.
Burnard, L., Baker, P., McEnery, A. & Wilson, A.
Receiver: 1. Evaluation, 2. Report, 3. Action.
X1 head head
Anaphora. Linguistics and Philosophy, 17;261- 327.
This session focussed on two inter-re lated issues: (I) per formance assessment for spoken language systems and (2) exper ience to date in speech corpora col lect ion for these systems. The session inc luded formal p resentat ions f rom representat ives of SRI International, MIT's Laboratory for Computer Science, BBN Systems and Technologies Corporation, and Carnegie Mel lon Univers i ty 's
d They tasted really good.
Each has relatively high accuracy. The four classifiers will be back off in sequence. If none of the four classifiers is applicable, a baseline model of assigning the most common semantic role of target word is applied.
We find this edge cannot be extended by any entry and is not finished, so we go to step 1 and pop the next entry ~ from the agenda.
Interaction Cycle 2K Interactions
A dialogue state and all agents that contributeto a dialogue state are shown in Figure 2. TheDialogue Model is used to classify the currentutterance into one of the dialogue act categories(Jokinen et al, 2001), and to predict the nextdialogue acts (Expect). The Topic Model rec-ognizes the domain, or discussion topic, of theuser input as described above.
MAORI katoa kino hoopara hiwahiwa
It is important to emphasize again that the judges were not made aware of the purpose of the experiment, nor were they told that any of the explanations were computer- generated.
model ing of ARABIC faces many
A. Zampolli. Oxford University Press.
Prepa- Seasoning ration
System Substitution
\[i'.fl',fr',tl*'.bl*',subst?'\] _ .
WAYNE STATE UNIVERSITY : DESCRIPTION of
Kozima, Hideki and Teiji Furugori. 1993.
Oxford 50562 Moby 52508
Scanner:(z1, x1) : [A ? ? ? a?, i, j](z1, x1) : [A ? ?a ? ?, i, j + 1]???(y1 : A ? ?a?) ? P0 ? i ? j < naj+1 = a
Gartin, S., et al 1994. W. Virginia Agriculture Teachers? Esti-mates of Magazine Article Readability. J. Agr. Ed. 35(1).
French string.
Youngjoong Ko
Comrie, B., (1976): Aspect: an Introduction to the Study of Verbal Aspect and Rela--~d Prob lems.~am- nlvers ty ress , -~r~-~g~.
The purpose o f the IS exper imentat ion In Eurot ra I s prec ise ly to min imize the number o f exp l l c l t t rans fer T - ru les and the ent i re modu lar des ign as i t has been proposed In the l ingu is t i c spec i f i ca t ions I s p r imar i l y geared towards an exper imentat ion process a imed at mak ing I t poss ib le to reach an opt ima l IS th rough mul t ip le cyc les o f p ro to typ lng .
La structure arborescente suivante, " ~A" " sera notre : " II I 0 A I ? lliIj Cette representation n'exclut pas, ~videmment, l'adJonetion d'autres informations sur un son.Jet donn~, et, en partlculier, de3 poin' teurs caract~risant son appartenance ~ une autre arborescence.
\[119\] A. Rosenhoover, "AFTI/F-16 Voice Interactive Avionics," Proc. IEEE National Aerospace and Electronics Conf., NAECON, pp. 613-617, 1986.
AI Applications, pp. 338-344, 1988
In Proceedings of the Second Conference on Applied Natural Language Processing. Asso-ciation for Computational Linguistics.
Dynamic Time Warping (DTW).
Abst ract
McKeown, Kathleen R. (1985). Discourse
(IV) If the pattern to be applied is at the lowest level, the api)lication fails. Otherwise, lower tile level of the patterns and execute (II).
Baseline 81.9% 78.2% 94.5% 50K 90.4% 47.2% 89.8% 53.1% 96.9% 44.4% 100K 91.8% 54.8% 91.3% 60.0% 97.2% 49.6% 200K 92.3% 57.4% 91.8% 62.4% 97.4% 53.4%
74 2.1 Evaluating Focus-Based Approaches Sidner's algorithmic account, although not ex-haustively specified, has lead to the implement- ation of focus-based approaches to anaphora resolution in several systems, e.g. PIE (Lin, 1995). However, evaluation of the approach as mainly consisted of manual analyses of small sets of problematic cases mentioned in the liter-ature. Precise evaluation over sizable corpora of real-world texts has only recently become pos-sible, through the resources provided as part of the MUC evaluations.
+hi:l -h i :2 - rnd: 2 +rnd: 1
20. Kannan, A., and Ostendorf, M., "A Comparison of Tra- jectory and Mixture Modeling in Segment-Based Word Recognition," Proc. IEEE Int. Conf. Acoust., Speech,
A A gt~ ix3 ,v - palm tree baobab
U: How about United.
P. F. Brown, S. Della Pietra, V. Della Pietra, and R. Mercer. 1993. "The Mathematics of Statisti-cal Machine Translation: Parameter Estimation".
Benjamin-Cummings Publisher. 1995 [9] Ken Hale. ?Preliminary Remarks on Configurationality,? Proceedings of NELS 12, pp. 86?96. 1982.
Further possible extensions to the work could involve trying t o specify a lexicon so tha t t h e generative process ends up with a structure with words as leaves, and one could also attempt to apply the rules in reverse, i . e . To start with a s t r ing of lords and produce a etructurdl description. Both problems are, of course, very d3f f i cu l t ones.
Bar-Ilan University
As some verbs occur less frequently than others wefelt it was important to use a relative rather than ab-solute threshold. For a threshold of 1%, we disre-gard any frames with a conditional probability ofless than or equal to 0.01. We carried out the evalu-ation in a similar way to (Schulte im Walde, 2002).
Suppose we apply the incremental algorithm to d1 from Figure 1 with ? type, color,size ? as preferred attributes. The type of d1 listed in the database is dog. This propertyis selected (since type information is always selected). It rules out d4 (which is a cat).
Simmons F.S. & Yu Y.H. (1992) "The Acquisition and Use of Context-dependent Grammars for English", Computational
SUB J(6/19,seize) =~ 0.I. 1 <CO>;
The DARPA ATIS1 test (for the February 1991 evaluations) has two mandatory test sets, the class A set and the class D1 set.
StAkE $malI
Abst rac t
F inal ly, the surface str ing "A bott le is a container", represented by node M226, is established to express node M75 and the answer to the query. In general, a surface sentence is generated to EXPRESS-2 a given semantic structure by first generating strings to EXPRESS-2 the sub-structures of the semantic structure and by assembling these strings into a network version of a list. Thus the semantic structure is processed in a bottom-up fashion.
Type declarations are organized into packages. A package will typically include a set of related annotation types. For example, a package may declare all the types of annotations used to represent the document structure for one message format (header, dateline, author, etc.). Another package, associated with an extraction system, would represent the annotation types corresponding to the template objects created by that system.
1 INTRODUCTION
that signal speech repairs and intonational Fluent Abridged Modification Fresh Intonational Feature Speech Repairs Repairs Starts Boundaries
Becket, Y. Schabes and K. Vijay Shanker.
SB Rosa by supper to was-invited ASN "\[She\] was invited by Rosa to dinner." (she=: Mary) I? after(2): marginal (*?) after(3): acceptable The extension (4) is a multi-zero-pronominal utterance.
Oepen, S. and J. Carroll (2000) Ambiguity packing inconstraint-based parsing ? practical results. In Pro-ceedings of the 1st Conference of the North AmericanChapter of the ACL, 162?169. Seattle, WA.
CONFERENCES 145th ANNUAL MEETING OF AAAS
20. Oviatt, S. L., Cohen, P. R, Fong, M. W. and Frank, M. P., A rapid semi-automatic simulation technique for interactive speech and handwriting, Proceedings of the 1992 International Conference Spoken Language Processing, vol. 2, University of Alberta, J. Ohala (ed.), October, 1992, 1351-1354.
The two kinds of presentation operators are treated if- ferently. Since top-down operators embody explicit com-municative norms, they are given a higher priority. Only when no top-down presentation operator is applicable, will a bottom-up resentation operator be chosen. The overall planning framework is realized by a function called Present. Taking as input a subproof, Present repeatedly executes a basic planning cycle until the input subproof is conveyed. Each cycle carries out one presentation op-erator, where Present always tries first to choose and apply a top-down operator. If impossible, a bottom-up operator will be chosen. The function Present is first called with the entire proof as the presentation task. The execution of a top-down presentation operator may gen-erate subtasks by calling it recursively.
The main loop of PHRED passes to the fetching component the set of constraints a PC pair must satisfy.
The following is the LF for the first utterance:
2 Higher-Order Unification and NL semantics The basic idea underlying the use of HOU for NL semantics i very simple: the typed A-calculus is used as a semantic representation la guage while se-mantically under-specified lements (e.g. anaphors and ellipses) are represented by free variables whose value is determined by solving higher-order equa-tions. For instance, the discourse (la) has (lb) as a semantic representation where the value of R is given by equation (lc) with solutions (ld) and (le).
Interests: Basic research on the b io lo~ca l effects ,of environmental hazards on man.
Syntactic analysis
Parsed
Pipelined Natural Language Generation Architecture
During the last half century sign languages havebeen recognized as genuine languages. Thus signlanguages are now accepted as minority languages,which coexist with majority languages (Neidle etal., 2000) and which are the native languages formany deaf people. Provision of information ac-cess and services in signed languages is as impor-tant as in other minority languages. Such provision,however, introduces theoretical and technical chal-lenges. The use of a sign language gesture nota-tion to drive virtual humans (avatars) for present-ing signing has been investigated (Kennaway, 2001).
Fawcett, R. P., Systemic Functiomd Grammar in a Cognitive Model of Language. University College, London. MImeo, 1973 Danes, F., ed., Papers on Functional Sentence Perspective, Academia, Publishing House of the Czechoslovak Academy of
Each PD node has a PD slot, a tagares slot, a valueNum slot, and a status slot. The PD slot contains a pointer to the represented PD itself.
3.1 Vector Rout ing Model
A t th i s po in t , the * ' s may be erased and, except fo r cate - gory labe ls , the IRL i s exact ly equ iva lent to the rewr i t ing ru les of the or ig ina l unaugmented SPG. The on ly funct ion the TS serves i s to reass ign labe ls . Ass ignment ru les a re t rans fer red and the sub- s t i tu te fo r the ax iom of DGt i s added, t SPGI and DG1 are very simple, with no embeddings and no optional rules. More complicated grammars give rise to problems of augmentation, especially for SPG. Even SPGI poses a problem.
With option of #8, option of Finite String as p a r t of this option, devote several cards of an issue to microfiche readers, t h e i r advantages and d i s - advantages and c o s t .
Precision Recall Precision Recall Accuracy BracketsWithout, Oct 16 90.74% 90.72% 84.62% 83.48% 94.95% 0.6With, Oct 16 94.19% 94.86% 91.63% 91.91% 98.00% 0.48With, Dec 9 97.33% 97.13% 95.40% 95.13% 98.64% 0.19Table 1. Improvement in parsing of questions.
Michael Dorna. 2000. A Library Package for the Verbmobil Interface Term. Verbmobil E,e- port 238, Institut fiir maschinelle Sprachverar- l)eitm~g.
Systems with Spoken Dialogue Interface
is able to create a less restrictive *restrictor. than these other approaches.
N(cat) \[S(np(dog))\]
Speech Technology and Research Laboratory
pnrted by the database management system, some extensions were necessary.
AGA 1 N
Havrfinek, B. and A. Jedli~ka (1963). Ceskd mluvnice.
1. If X=\[\] and Y=\[\], then stop; else if X=\[\] (Y=\[\]) then mark all segments in Y (X) as "inserted" ("omitted") and stop; else continue.
Lehrer & Kittay (eds.) (1992) Frames, Fields, and
Palmer, M. S.: Semantic processing for finit? domains, CUP: Cambridge, 1990.
I the the
1) A schema candidate s ( iek ) assoc iated with c ( t ) is ac t ivated , i .e . the const i tuent c ( t ) take ? the rote of a regent . Fol lowing the environment descr ip t ion in s ( i , k ) , dependents fo r c ( i ) are searched from i t s immediate neighbourhood. Go to the step 2 with j ? i -1 .
> > D E C I D E : DOE$ *IRVINGBIRD* IGNORE THE THREAT? *NO IRVING BIRD DECIDED HE WOULD TELL JOE BEAR WHERE THE HONEY WAS, I R V I N G B I R D TOLD HIM IT WAS AT THE BEEHIVE.
~cprovcntation and Understanding 24
Ideal versus simulated Log-likelihood finding pairs of words that occurred next to each other with a significantly higher frequency than would be expected, based on the word frequencies alone. The text was 31,777 words of financial text largely describing market conditions for 1986 and 1987.
Classification and Fact Retrieval in
The antecedent indicators (as described above) will be used for the final weighting of the candi-dates and for proposing the antecedent. The candidate with the highest overall score after stages d) and e) will be picked up as the most likely antecedent.
The user then moves to the Structuring interface by clicking on the "Structurer" button at the top of the window. Note that the user can return at any point to the Segmentation i terface, to change seg-ment boundaries, or edit text. These changes are automatically accounted for in the structuring com-ponent.
Moving 2 0.33
Appelt took a different approach: his planning-based generator manipulated word order explicitly/Appelt 1985/.
Table 1: The relation between the length of the path between two nouns X and Y (fen(X, Y)) in Bunruigoihyo and their relative similarity (sire(X, Y)) len(X,Y) 0 2 4 6 8 10 12 sim(X,Y) 11 10 9 8 7 5 0 input \[ ncl-rr ~81,Cl database ?s2,cl mel nc2-rnc2 ne3-mc3 v (?) esl ,e2 Esl,ca - - v ( s l ) ?82,e2 ?S2 ,C3 ?82,e4 v (82) ?83,e2 ?83,c3 - - v (83)
MISC 71.51 39.70 51.06
considerable, extensive, in termi t tent , l i t t l e absent, evident, Fnown, possible, present ac t ive , bad, benign, degenerative, firm, hard, malignant, metastatpc, nodular adjoining, d i s t a l , dorsal, f ron ta l , l e f t c lea r , f ree , healthy, negative, normal
VECTOR QUANTIZER D ISTORTION
4b. The 0 men 2 won 0 over 1 their 0 enemies.
D.2. An atom is an element, or an element immediately preceded by "NOT".
V=2 4
6 Acknowledgements
Termr in the definit ions (elements of the coverfng set) are also qonsidored l e x i c a l items, L e . even multiword entl.t~es appear as a sfnple un i t and are represented by at most 10 characters, The bas ic vocabulary, that is the covering set, consist^ of elements tha.t also appeap i n thq pvered set-. In our particular case, they are non-technical words used t o aefine the technical t e n s of t-he computer dictiwanfi. d e f i n i t e d i s t i n c t i o n was made between content wbras and functiqn words (also called operators), The latter were not bnclud&d in the covefing set nor were they counted in determining the length of definit ions.
Figure 4: Sample 'Danslations
AINE 6
VP v NP,I.
For a g iven s t ruc ture there may be more than one adequate word. In that case the appropr ia te word is chosen by the user in teract ive ly .
G M
AUTONOMOUS no
Notice that (5b) cannot be generated by the original CCG- Std where the lexicon does not involve GTRCs. In order to (statically) simulate (5b) by a CCG-Std, we add S\BkA to the value of f" (c) in the lexicon of G'. Let us call this type of relation between the original S\A\B and the S\B\]\A\] wrapping, due to its resemblance to the new operation of the same name in (Bach, 1979). There are two potential problems with this simple augmentation.
Rule : s => np,pp,vp
I INTERMEDIATE
Fig.4:Hierarchies of ?sokumen (one side)?
In other words, the "conceptua l symbols" do not represent separate p ieces of the univers de disoour8 taken at random, but are probab ly ordered by some c lass i f i ca t iona l system, resembl ing the b io log ica l c lass i f i ca t ion .
'~ . . . . . . . . YEAR . . . . .
For the seen adjective-noun bigrams, we used the data of Lapata, McDonald, andKeller (1999), who compiled a set of 90 bigrams as follows. First, 30 adjectives wererandomly chosen from a part-of-speech-tagged and lemmatized version of the BNCso that each adjective had exactly two senses according to WordNet (Miller et al 1990)and was unambiguously tagged as ?adjective? 98.6% of the time. Lapata, McDonald,and Keller used the part-of-speech-tagged version that is made available with the BNCand was tagged using CLAWS4 (Leech, Garside, and Bryant 1994), a probabilistic part-of-speech tagger, with error rate ranging from 3% to 4%. The lemmatized version ofthe corpus was obtained using Karp et al?s (1992) morphological analyzer.
Via Santa Maria 36
3. If location information about both the manufacturer and owner are available, use the location of the owner.
Notice that these quest ions are the same ones that must be asked about ANY model ii of memory processes. The reason for this is obvious: COMPREHENSION IS A MEMORY PROCESS.
We evaluate NE recognition with morp model and feature model since POS statistical data, which is extracted from labeled corpus, has some POS tagging error, and root model cannot be implemented due to the difficult to determine what the root is. Therefore, in this paper we suggest the evaluation of the morp model, feature model and morp/feature model considering forward/backward view: (1) morp model based forward view [M/F], (2) morp model based backward view [M/B], (3) morp/feature model based forward view [MF/F], (4) morp/feature model based backward view [MF/B], (5) morp/feature model based forward/backward view [MF /FB], which combination of forward/backward view is based on forward-backward algorithm. We give 0.93 weight to morp model and give 0.07 weight to feature model. It is optimized from many experiments.
The rules that RIPPER learned on the basis of the Exchange 1 automatic features are below.
The result ing program, chara l ign , works at the character level using an approach inspired by the cognate method proposed in S imard et al(1992).
A system as a substitution for call centers.
? He has a hardware project to do.
The NLParse commands reflect these conventions and were included in the corpus to facilitate maintenance since it was usually easier to determine the correctness of the reference answer by looking at the NLParse com-mand rather than the resulting SQL expression. In the event of an erroneous answer, correction occurs by sim-ply amending the NLParse command.
For the relations, fire units stand for characteristics of the relation itself Note that this differs from most other approaches in treating each role or relation as a distributed pattern. This has several virtues. For one thing, it immediately eliminates the problem of specifying a small set of case roles, in the face of the fact that there seem to he a very large number of very subtle differences between roles that are in many ways very similar. Further, the use of distributed representations allows us to capture both the similarities and differences among case roles. The idea has been proposed on independent linguistic grounds, as well.
Co., Dordrecht, The Netherlands.
V.b:<agr pers>= S,
A sentence generation corresponds to the speaker's speech process. Accordingly, if a sentence of good quality is needed, many factors of a speaker should be incorporated. However we restrict ourselves to treating only the syntac-tic and semantic factors. The pragmatic factors remained as future problems.
Santa Monica, 1983.
In the overall construction processes, the task to compile the syntactic structure of source sentence into the TCT representation by linking the trans-lation fragments from the target sentence is the vital part. The following steps present the com-plete process to generate an TCT structure for a translation example ?Actos anteriores ? publici-dade da ac??o (Publicity of action prior to acts) / ????????????.
? by choosing a combinator f om a menu, ? by entering a string that is parsed, ? by reading a previously defined object from a file, ? by using an automatic search of suitable instantia-tions.
The automatic tagger is truly automatic in that it has not at all been adjusted to the specific task at hand.
YR23: Y devant U, YU, SHE, PE, LE, VE, BE transl.: E -+ Q
October 2000, Hong Kong, pp. 85-92.
Linguistics, 6, pp.167-182.
Suri (1993) performed a critical analysis of the experiment that explained why other factors uch as the infrequency of indefinite subjects in naturally occurring dis-course, the use of passive or active voice, certain lexical choices, (potentially) stronger reader identification with a victim/near-victim (orwith a criminal), and order of text presentation could not explain the distribution of judgments in our experiment. For example, one may suspect hat the use of the passive as in $1 of both Example 5 and Example 6 may influence the judgments given. However, the experiment contained pairs of examples where passive sentences were used for $1 and one was judged ac-ceptable and the other unacceptable bythe participants. Similar. pairs of examples with $1 in active voice were included with the same results. Thus it must be the case that the judgments given were attributable tosome factor other than active/passive oice.
FEB91-SD 13.9
Michael Maxwell
Thismeans the agreement between Semcor and DSO isquite low.
TR, (iii) if the quest ion has the form "Which N " (i.e the wh-n~de depends on its ? o - , o head in the relat ion of general relat ion- ship), then also those TR's are preserved that contain an identical N node (noun) on any level of the tree.
Ravichandran, D. and E.H. Hovy. 2002. Learning Surface Text Patterns for a Question Answering System. Proceedings of the ACL conference.
T. WmOGRAD, Understanding Natural
The point in my discussion, is not to say that an approach is much better than the other for terminology, regardless of the application at hand.
2 We use the Jyutping romanization developed by the Linguistics Society of Hong Kong in 1993. See http://www.cpct92.cityu.edu.hk/lshk.
II 13 It 12 I
Det N'
DBTG (Data Base Task Group), 377-380
4. Mode l Select ion
FORM CATEGORIES 0 1 0 0
We begin by rescoring the ?fl?w? -best lists from thebigram lattices with trigram models. For each teststory   , we perform CLIR using the first pass ASRoutput to choose the most similar English docu-ment   from NAB-TDT. Then we create the cross-lingual unigram model of (1). We also find the inter-polation weight]which maximizes the likelihoodof the 1-best hypotheses of all test utterances fromthe first ASR pass. Table 1 shows the perplexity and
WordNet synset Similaritypopulation N people 0.388population N group grouping 0.336population N colonization colonisation settlement 0.218Table 3: Population: a group of human inhabitants, or a group of organisms?not co-occur often enough with other words to beable to provide enough information, either. Thisproblem can be solved, however, by a better selec-tion of seedwords, or, more easily, simply by usinga bigger corpus to alleviate the sparse data problem.
Input automata with 25 states . . . . . i . . . . . . . . i ~e m + ? \[\] +
A r e a d a b l e way of hand l ing such c l a u s e s is t h e method used i n J u n c t i o n Grammar: The proform with r e s p e c t t o which t h e modi-fication occurs i s d i r e c t l y jo ined t o t h e noun being modified.
2001. Interactive conceptual tutoring in atlas-andes.
2.2 An experimental procedure for understanding derived nouns and compounds In an experimental program, implemented inLPA MacProlog, we structured a very restricted lexicon of Swedish stems and affixes (basal lexical ent,'ies, BI.A) according to the approach outlined above. Each verbal stem was provided with a list of elements of its typical event refer-ent, e.g.: lex(\[ l~ir\],m(teach,stem),v,vt,\[ agent, sem_object,domain,place,time,resultl,\[\]).
For instance, any value for the lngredientOf attribute is automatically compared to tile Itypernym wflue(s) lk)r each other senses. This comparison reflects tile fact that maBy nouns are both the nalne for a substance and tor something which is made li'om that substance. An exanrple of this is the noun "coffee": in one sense, "coffee" is hlgredientOf of a "drink", while in another sense it has been klentified as a Hypernym of the noun "drink".
RSCM on an SMT system.
For example, if the forward and backward paths reachthe same search-state, then the forward searcher quicklyreaches the goal by tracing the backward-path.
Computer Science.
2Note that there are many potential sources of standards forsmall that FIGLET does not currently pursue. E.g. the averagesize of all objects already in the figure. We believe that generalIn tandem with its response, FIGLET tracks thechanges to the context. The task context is updatedto note that the user has drawn the eyes and mustcontinue with the process of creating and revisingthe features of the face. The linguistic context isupdated to include the new small standard, and toplace the eyes in focus.
Language Processing inLisp.
Preposition in PP by till,untill,to,into,down from with,by of, about for at,in,on,under at,in,before,after,about,by,on,during for none in,with by,for,because of in ,into (1.4) The letter eached \[Goal John\] yesterday.
Gale, William; Church, Kenneth; and
2 Previous Work
The proposed formal i sm ut i l i zes more res t r i c ted memm tilmt GPSG but o f fe rs g reater poss ib i l i t i es for express ing genera l i za t ions . The el im inat :ion of metaru les and the in t roduct ion of CCRs g ive i t a taore Ii~uogeneous s t ruc t :a re and place cooccur rence res t r i c t ions of var ious k inds in the center of attention.
Formal ~orpho log?
It uses the rules of the grammar in a form where the metarules have been applied, but the permu-tations implied by the LP rules have not been explicitly expanded. This means that we have fewer rules to worry about, but silghtly more work to do each time we apply one (since we have to check that we are applying it in a way allowed by the LP rules). The extra work is minimised by using the LP rules, at the time when the grammar is first read in, to index ID rules by their possible legal initial substructures. This prevents the parser trying out completely point- less rules.
Linguistics, 13(3-4\].
5) Copy of screen can be taken by the hard copy unit attached to it.
Mikheev, A., 1997. LT POS - the LTG part o/speech tagger. Language Technology Group, University of Edinburgh. www.ltg.ed.ac.uk/software/pos.
Although the programs of Marcus and Riesbeck share many of these same properties, the syntactic processing aspects of those programs are not clearly separated from the particular conceptual representa-tions on which they are based. We believe that the parsing algorithm presented here captures many of the important properties of those programs so that they may be applied to conceptual representations based on other theories of natural language.
First of all, we set the number of features in eachclassifier using validation set of training data.
4.Means Verb + "by" t make, prepare, draw v t 4e4,, (Process) Gerund form, shape l1 shape (glass) -.
A06 0.35 0.7 0.044 B06 0.36 0.2 0.011
Pisa, 1984b, pp. 167-176.
---> a12 a---> a13 6--> ell --~ el2 ---> el3 Figure 2 ? Examples of the code for accented characters
3.3 Generation architecture and aggregation localization While its overall architecture is a conventional pipeline, HYSSOP is unique in encapsulating allaggregation processing in the sentence planner and carrying it out entirely on a deep semantic representation. I contrast, most other systems distribute aggregation over several processing components and across several levels of internal representations: deep semantic, thematic and even surface syntactic for some of them.
Monica, California, The Rand
A second method that helped avoid local optima was the use of combined actions. In addition to single splits or merges, we search over segmentations produced by split-ting a segment and merging the first or second half with the previous or next segment respectively. In essence, this ex-pands the search neighborhood by including the neighbors 3 and 4 in figure 1.
E*,Z
Table 2: Average number of homographs withequal frequencies per pair of parallel texts (aver-age percentage of homographs inside brackets).
5 Acknowledgements
B. Heuft 1999. F, ine prominenzbasierte M thode zttt Prosodieanalyse trod -synthese. Peter Lang, Frank- furt.
Ted Dunning. 1993. Accurate methods for statistics ofsurprise and coincidence. Computational Linguistics,19(1):61?74.
The tagger has three kinds of knowledge: abase lexicon, contextual rules and lexical rules.
When the user selects option four he/she will get the following output: the input word ~.-~.
Information, 1, pp. 203-233.
In most research on concept acquisition from corpora, concepts are modeled as vectors of relations extracted from syntactic structures.
The detection of abbreviations in a text corpus forms one of the initial steps in tokenization (cf.
Gibson, E., Schutze, C., & Salomon, A. (1996). The relationship between the frequency and the processing complexity of linguistic structure. Journal of Psycholinguistic Research 25(1), 59-92.
PER ANN STEN 0.226257
Error Measures and Bayes Decision Rules Revisited
"Language type" decides if every character in the language can be an MF. In non-segmented language every character can be an MF. In segmented language, punctuation marks and sequences of characters except for delimiters can be an MF.
Foothill/DeAnza College
Given an instance of ambiguous prepositional phrase attachment from the test set, the lexical association pro-cedure for guessing attachments u ed the t-score \[Church et aL, 1991\] to assess the direction and significance of the difference between Pr(p\[n 1) and Pr(plv) - - t will be positive, zero, or negative according to whether Pr(pln 1) is greater, equal to, or less than Pr(plv), respectively, and its magnitude indicates the level of confidence in the significance of this difference.
NP VP
Table 2 shows the results of person name extraction.
The goal of this initial won is to assess human-human problems solving in the air travel domain, and to assess possible differences between human-human and human-machine interactions. It is clear that people are very adaptable, far more so than our current technology. It is not so clear how adaptable they will be and on what dimensions in human-machine interactions. What aspects of the interaction will require a technological solution and what aspects can be handled via a human factors solution? If, for example, it is desirable to handle only database queries, how difficult is it for humans to adapt to this restriction? This is but one example of a myriad of similar questions that could be asked using such simulations. The answers to these questions will expedite the design of efficient human-machine collaborative systems.
Retrieval -3000 documents per
Kay, Martin (1984) Functional Unification
tlowever in a construction-based fmmalism, the interaction between the constructions can be predicted by examining the semantics of the constructions. In tile Dative rule, the Goal participant must be focused on as having some sort of control over the Theme. The point is that what i~ means for a Goal participant to be affected in a Goal- transfer scenalio is for the Goal to be transferred possession or control of tile Theme.
Levy, and Takahashi (Joshi et al, 1975; Joshi and Schabes, 1997). The primitive elements of an LTAG are elementary trees (etrees).
Lastly, for the purposes of this simulation, we do not distinguish between the syntactic roles of subject and object, and semantic roles of agent and patient, even though a more complex model may separate these levels and include a process that maps between them. Although these simulations conflate the syntactic and semantic categories, we use the terms agent / patient for clarity in linking to the Dick et al empirical data.
Finally, future work will mainly fbcus on how the system can invoke all existing information in order to generate new translations, mainly aiming at automatic and (senti-) automatic methods for "recursive" as well as "parallel" utilization of multiple translation rules towards optimal "coverage" of new incoming sentences.
Church, Kenneth W. (1988). "A stochastic parts program and noun phrase parser for unrestricted text." In Proceedings, Second Conference on Applied Natural Language
NL generation only makes ense when 1) The data to be communicated is already present in an existing database (knowledge base etcO (em-phasis added) 2) The users need the information, and want it presented as text (e.g., instead of graphically) 3) The volume of documentation justifies the expense of building an NLG system.
For words ending in superheavy syllables too, alternation exists only between R(egular) and I(rregular) patterns. The regular ones (final stress) are predicted with 96.80% accuracy for Encoding 2 and 96.35% for Encoding 3. The irregular patterns reach success cores of 55.83% for Encoding 2 and 61.67% for Encoding 3, again yield-ing a highly significant difference.
Other general commonsense knowledge is built on top of this naive topolog'y. The domain of time is seen as a particular kind of scale defined by change of state, and the axiomatization builds toward such predicates as "regular" and "persist". The domain of belief has three principal subclusters in this application: learning, which includes such predicates as "find", "test" and "manifest"; reasoning, explicating predicates such as "leads-to" and "consistent"; and classifying, with such predicates as "distinguish", "dif-ferentiate" and "identify". The domain of modalities expli- cates such concepts as necessity, possibility, and likelihood.
3.2 Preferences
We describe a generative probabilistic model of natural an- guage, which we call HBG, that takes advantage of detailed linguistic information to resolve ambiguity. HBG incorpo-rates lexical, syntactic, semantic, and structural information from the parse tree into the disambiguation process in a novel way. We use a corpus of bracketed sentences, called a Tree-bank, in combination with decision tree building to tease out the relevant aspects of a parse tree that will determine the correct parse of a sentence. This stands in contrast o the usual approach of further grammar tailoring via the usual linguistic introspection i the hope of generating the correct parse. In head-to-head tests against one of the best existing robust probabflistic parsing models, which we call P-CFG, the HBG model significantly outperforms P-CFG, increasing the parsing accuracy rate from 60% to 75%, a 37% reduction in error.
The current study demonstrates (1) that the perceptualprimitive of contact (available to infants at 5 months), canbe used to perform event description in a manner that issimilar to but significantly simpler than Siskind (2001),(2) that a novel implementation of principles fromconstruction grammar can be used to map sentence formto these meanings together in an integrated system, (3)that relative clauses can be processed in a manner that issimilar to, but requires less specific machinery (e.g. nostack) than that in Miikkalanian (1996), and finally (4)that the resulting system displays robust acquisitionbehavior that reproduces certain observations fromdevelopmental studies with very modest ?innate?language specificity.
\[18\] Nomura, M. and Ishii, M. (1989) Gakujutu
London: Frances P~nter.
APPENDIX. COMPUTATIONAL, DATA, AND STORAGE REQUIREMENTS It is important to point out at the outset hat he fast computing that is needed for research in spoken language systems does not defive so much from the need to achieve real-time with compute-intensive algofithms, for, given a particular algorithm, it has always been possible to build special-purpose hardware to perform the computations in real-time.
Concept: \[ #HAS-TYPE ( #object $OBJECT #type $TYPE ) \]
Chomsky, N. Problems of knowledge and freedom.
It is as well at this point, however, to sound a cau- tionary note. We have not yet examined in full thoee cases where de-elefting leaves a state-expression. The prediction is that these cases should not seem as bad as when de-clefting reveals an event-expression, but we have not yet tested the prediction.
F i rs t we consider the problems of intensional logic. The model of intenslonal logo comes to be more complicated because it has a greater descriptive power than predicate logic in general. As Gall\[hi3\] pointed out, valid formulas in intensiona\[ logic fail to constitute a recurs\[rely enumerable set since it is essentially based on type theory. Thus we have no axiomatization for this logic. For this reason, we must restrict the scope of sentences in natural language capable of being treated by intensional logic. But the notation of intens~onal logic used in PTfi such as '" and '~' work efficiently for analysis, For example, consider the following sentences.
\[RICH87\] Rich, Barnett, Wittenberg,
The 11-point average precision value, corresponding result to monolingual (C/M), and performance change are summarized in Table 2.
Alennder P. D. Mourelatos, Events,
Cruz, CA, USA.
M 0 = argmax P(M o I W, H).
Theorem 3.
14 As discussed above, this problem with Hawkins's and Prince's classification schemes had already been noted by Fraurud--e.g., Fraurud (1990, 416).
Invention coin, contrive
Speech Processing
Annotated Trace of UCEgo's Plan Selection Process.
Analysis: The user?s goal is to identify biochemicalpathways potentially connecting retinal diseases and cur-cumin. Retinal diseases could result from complicationsdue to diabetes, or of infection and inflammation of theretina.
Kawagoe, Saitama, Japan
SR L 99.8 76.7 75.8 77.8 77.0 33,740
CURRENT from TODO; /* loop over a l l product ions whose last element = name of c u r r e n t span */ ( V D E F E GRAMMAR(DEF(#DEF) eq SPAN(CURRENT, ' N A M E ' ) ) /* separate left and r i g h t sides of produc t ion */
3 Negation
Martin HOLUB
"'Rhetorical Structure Theory: Toward a functional theory of text organization." Text 8(3). 243-28 I.
we will ignore the escape symbol (Z) that should precede any special characters (e.g., +) used in these rules.
It differs f rom LOB in that it is Amer ican Engl ish and, more importantly, in that it is completely made up of newspaper text. The material is tagged with the Penn Treebank tagset (Marcus, Santorini, and Marcinkiewicz 1993), wh ich is much smaller than the LOB one. It consists of only 48 tags. 13 There is no attempt to annotate compound words, so there are no ditto tags.
Endin~ an analogy conversational move, makes available to the grammar the "Resume-lnitlatlng" discourse expectation, created when the analogy was first generated. The effects of choosing this discourse expactation are to: 11Lacking from thls theory, however, but hopefully to be inc luded a t a la ter date , i s Webber 's not ion o f evoked entities \ [27\] (i.e., entities not previously mentioned in the discourse but which are derivative from it - especially, quantified sets).
Most of the EUFID design goals were actual ly met. EUFID runs on a mini- computer, a DEC PDP 11/70. It is appli- cation, database, and DBMS independent.
(3) $1 So we'll switch you to a double room. okay? (4) S1 So we'll switch you to a double room.
CSL\[, Stanford, Callfo~n\[a 1984 ; x
ANT LF 124 66.94 73.39
Ad j -discover
Mechanisms for Language Processing.
Vol. 1, 43-46.
Regarding the supervised learning approachesapplied, we find AdaBoost, Naive Bayes, vector?based cosine similarity, and Decision Lists (SWATsystems), Decision Trees (Duluth-CLSS), Support3All the datasets of the Catalan Lexical Sample taskand an extended version of this paper are available at:http://www.lsi.upc.es/ \00 nlp/senseval-3/Catalan.html.
Edit Dist.
The two main features of the technique we are using seem to be (a) the use of probabilistic methods for disambiguation of linguistic structures, and (b) the use of a corpus of unconstrained English text as a testbed for our methods, as a source of information about the statistical properties of language, and as an indicator of what are the important areas of inadequacy in each stage of the analysis system.
Note 99.2 50.9 99.7 80.8
Figure 1 shows some examples of TS, where the wordsin italics represent the SL query, and the words in bold arethe SL and TL answers.
Applications, 38: 56-58.
S: \[BRENNANu: Brennan,
la. B. Katz and P.tl. Winston, "A Two-way Natural Language Interface," in Integrated Interactive 6'omputing Systems, edited by P. l)egano and E. Sandewall, North-Ilolland, Amsterdam, 1982.
HowNet is a Chinese ontology with a graph structure of word senses called ?concepts?, and each concept contains 7 fields including lexical entries in Chinese, English gloss, POS tags for the word in Chinese and English, and a definition of the concept including its category and semantic relations (Dong and Dong, 2000). For example, one translation for ?beat.v? is ?: In this work, we make use of contextual lexical entries from the same semantic frame, as illustrated above. In this example, the ?cause_harm? frame contains two lexical entries??beat.v? and ?strike.v?.
4.3 QLF Axioms
[ 4 ] Bobrow, D. G. and J. B. Fraser, "A Phonological Rule T e ~ t e r , ~ Comm. ACM, Volume 11, November, 1968, 766-772.
CSLI Online Publications.
Littlestone, Nick, and Manfred Warmuth.
The file-type table simply tells M-COOL whether the given knowledge source is lexical or semantic, and whether it is for generation or analysis. It also supplies miscellaneous information such as the name of the file where the run-time entries are kept and whether it can be compiled using the LISP compile command. For example, our Spanish-lexical-analysis file-type is defined with this entry:
Training 1882
6.1 Supertagger Accuracy
For each syntactic category the corresponding .-it- tributes are defined, for each attribute the set of pos-sible values is defined. So, given a set of syntactic relations and a set of syntactic categories with the cor-responding attributes and values, the set of possible S-trees is defined. This set is called T: the domain of
VNPPPto NP <- NP PP.
MULTEXT (Multilingual Text Tools and Corpora)
There are many ways in which the simple models described in this paper can be improved. We expect some improve-ment from estimating the parameters on more data. For the experiments described above, we estimated the parameters of the models from only a small fraction of the data we have
We assume a morphological component such as GERTWOL (1996) to apply before the composi-tional process tarts. Composition itself is imple-mented as follows, relying on a separate lexicon for particles. The particle lexicon is hierarchically structured and lists selectional restrictions with respect to the base verb selected. An example for the hierarchical structure isgiven in figure 7 (with-out selectional restrictions for matters of simplic-ity), where heraus- is a hyponym of her- and aus-.
A number of recent research efforts have explicitly grounded parser design on linguistic theory (e.g., Bayer et al (1985), Berwick and Weinberg (1984), Marcus (1980), Reyle and Frey (1983), and Wehrli (1983)). Although many of these parsers are based on generative grammar, and transformational grammar in particular, with few exceptions (Wehrli (1983)) the modular approach as suggested by this theory has been lagging (Barton (1984)). Moreover, Chomsky (1986) has recently suggested that rule-based parsers are implausible and that parsers could be based on lexical properties and structure determining principles.
Lynne Higbie, and Tom Howard; "Cable
A: walk across a platform
We a lso de f ine the ent ropy , H or H(M), fo r the grammar as n= 1 (1). = x.H.
4.1 Problems with Commonly Used MeasuresThe Dice coefficient computed for bigrams (BI-GRAM) is an example of a measure that is demon-strably inappropriate for estimating word similar-ity. Because it is based exclusively on com-plete bigrams, it often fails to discover any sim-ilarity between words that look very much alike.
IDS . (2000). lnternet Domain Survey.
If the VALUE-slot is satisfied by FILLER, <action-l> will be activated to make further semantic interpretation if necessary. Let us consider another example:
Definitions of relations of this sort specify constraints hat apply to the nucleus (N), the satellite (S), and the combination of the two and specify the effects of the expression.
Ju ly 1 ducat ion Programs Beginning after J a n ~ a r y 1, 1976 Roger R o s e ~ b l a t t , Divi-sion Director -202-382-5891 Procjrhm grants for c r i t i c a l re-examination of t h e content, o r g a h i z a t i o n , and method of presenta t ion of a group of related courses or an ordered program of study in the humanities. The central topic can be a region, culture, era, etc.; o r a program can be defined by a cur r -i cu la r level. L i m i t , $ 1 8 0 , 0 0 0 i n three years.
Stevenson, S. (1994). A competitive attachment model for resolving syntactic ambiguities innatural language parsing. Doctoral dissertation, University of Maryland,
Given two feature structures, the graded unification mechanism (Ua) computes two results, a unifying struc-ture and a unification strength.
Ralph Weischedel, Damaris Ayuso, Sean Boisen ,
M.S. Chodorow, RJ.Byrd, G.E. Heidorn, Extracting semantic hierarchies from a large on-line dictionary, in Proceedings of the 23rd Annual Meeting of the ACL, Chicago (Ill), 1985, 299-304.
D. Marcu, L. Carlson, and M. Watanabe. 2000. Anempirical study in multilingual natural languagegeneration: What should a text planner do? In Pro-ceedings of INLG?2000, pages 17?23, Mitzpe Ra-mon, Israel.
Table 11: Precision and Recall of SO-PMI of the test set words with 3 different groups of 6 morphemes The precision remains high from 20 morphemes to 6 morphemes, but from table 10 the precision varies with different sets of morphemes. Group 3 gave the lowest precision of 68.77%, whereas other groups gave a high precision close to 80%.
In addition to showing the theoretical advantage of being able to provide many of the fine-tuning capabilities of so-called semantic grammars within the context of a domain-independent grammar, we demonstrate several practical benefits to our approach. For example, the conciseness of our formalism allows shorter grammars than many previous formalisms would allow, at least for the intended class of retrieval applications. This offers not only added perspicuity but other benefits as well. For instance, we have been able to write simple (almost rivial) LISP routines that pre-process a grammar to construct he files used by the parser to increase efficiency and to perform valuable disambiguations.
TAG's, HG's, and MHG's.
Grishman, R. 1996. TIPSTER Architecture Design Document Version 2.2. Technical report, DARPA.
Training Testing
Steve Cassidy & Steven Bird (2000) Querying databases of annotated speech, Proceedings of the Eleventh Australasian Database Conference, http://www.ldc.upenn.edu/Papers/ADC2000/adc00.pdf Center for Language and Speech Processing (2000)
The questions, "what class does a verb belong to?", "what are the relative frequencies of the dif-ferent patterns it occurs in?", and "is this pattern grammaticalT' are intimately connected. Alterna-tion behaviour is a major source of evidence as to how a verb should be classified, and grammaticality judgements are premised upon the patterns a com-petent speaker has frequently encountered in their experience of the language. The further develop-ment of computational lexical semantics of the kind described in this paper requires foundational work on the relation of corpus-based statistical findings to formal knowledge representation.
Adjective-noun plausibility served as a test bed for a number of corpus-based models of linguistic plausi-bility. Plausibility judgements were obtained from hu-man subjects for 90 randomly selected adjective-noun pairs. The ratings revealed a clear effect of familiarity of the adjective-noun pair (operationalised by corpus co-occurrence frequency).
For ins tance , given: $1%O: $KHI:
1 Introduction
(Walker et al, 1998) observe anecdotally that userslearn system vocabulary over time. (Yankelovich,1996) and (Kamm et al, 1998) explore techniquesto guide users to produce well-formed queries, witha variety of strategies and tutorials, respectively. Theabove studies have focused on pure novice userswithin their first few interactions with the systemand on the goal of task achievement. Here, we ana-lyze quantitatively the process by which users learnthe language understood by the system, by exploringnatural interactions during the course of a field trialconducted over a period of months. We analyze notonly task completion or command recognition, butalso the vocabulary acquired itself.
3.3 Recogn iz ing Tables in New Texts 3.3.1 Boundary Every hline generates a test example and a classi-fier assigns the example as either positive (within a ~'In generating the feature values for table row recognition, only the vlines enclosed within the identified first and last column of the table are considered.
Unlike specialized terminology, however, propernames are amenable to a speech-inspired translationapproach. One tries, when writing foreign names inones own language, to preserve the way it sounds.
Mitiko SUBJ wife OBJ/EMP chairman OBJ2 recommend-gave Mitiko did my wife a //avor in recommending her as chairperson.
7'he wall is part of a housc. \[n some (:rises, the he:gallon of \[A is ingr It\] suggests the ingredi(mcc of the object A to another type (J, such that there exists a type 1) which is greater than 13 and (7 in the lattice of types : The spoke wheel is not a part of a ear (it Zs part of a bike').
Total 79 2 7 214 0 138 1.000 0.898 0.946Table 4: The learner is trained using only positive examples. Positive examples are tested with the leave-one-outmethodology. Negative examples are tested on rules learned with all positive examples.
Xxxx+ area
These systems promise to make major improvements inthe ease of use of data base management and other computer systems. However, they have only begun to l This material is based upon work supported in part by the National Science Foundation under Grant Nos. 1ST-8009673 and IST-8311400 and in part by the Defense Advanced Research Pro-jects Agency under Contract No. MDA 903-81-C-0335, ARPA Order No. 2223. Views and conclusions contained in this paper are the authors' and should not be interpreted as representing the official opinion or policy of DARPA, the U.S. Government, or any person or agency connected with them.
Finally, in Section 6, we draw conclusions and propose some future work.
The dialog system exclusive of the parser and error correction code consists of about 17,000 lines of Prolog (and this includes ome comments) apportioned as follows: Dialog Controller procedural mechanisms (including IPSIM) 15%, Dialog Controller knowledge base 11%, Domain Processing procedural mechanisms 25%, Domain Pro-cessing knowledge base 14%, Linguistic Interface including much language generation code 30%, miscellaneous 5%.
/* Translation Rules */ translate(Syn,LogForml) :- transmod(Syn,8-true,8-LogForm), simplify(LogForm,\[ \],LogForml).
N21 Right.
Proceedings of AMIA Symposium 1999:181-5.
Developed an approach for constructing acoustic models for telephone applications using high-quality recordings, resulting in a substantial savings in effort when porting the ATIS application to a telephone envkonment.
In: K. Spazk Jones and Y. Wilks (eds.), Automa- tic Natural Language Parsing, M~morand%~n I0, Cognitive Studies Centre, University of Essex.
The goal here is to provide an automatic process that can take advantage of the large degree of similarity frequently found between different rules in a unification grammar by overlap-ping their storage or execution paths. While the modularity and declarative nature of such a grammar are well-served by representing each of a family of related possibilities with its own rule, storing and testing and instantiating each role sep-arately can be quite expensive. If common rule segments could be automatically identified, they could be partially merged, reducing both the storage space for them and the computational cost of matching against hem.
2. Baseforms made from a single utterance.
CNTS - Language Technology Group
X stems from Y X eases Y *Y results in X Y is related to X *X is result of Y X is linked to Y
Working Papers of the lnll"illcr Project, available I,y gopher from dsv .su .se : /pub/ In tF i \ ] te r .
The semantic role played by the immediate parental semantic onstituent of the word.
292 Computational Linguistics, Volume 12, Number 4, October-December 1986 Bradley A. Goodman Reference Identification and Reference Identification Failures
( 5 % ) The horse r aced p a s t t h e barn f e l l .
Samuelsson, C. 1994. Grammar Specialization through Entropy Thresholds. Proc. ACL-94, Las
We separate the problem of FrameNet tagging into three subsequent processes: 1) sentence segmentation 2) frame element identification, and 3) semantic role tagging. We assume the frame element (FE) boundaries match the parse constituents, so we segment a sentence based on parse constituents. We consider steps 2) and 3) as classification problems. In frame element identification, we use a binary classifier to determine if each parse constituent is a FE or not, while, in semantic role tagging, we classify each 1 http://www.icsi.berkeley.edu/~framenet identified FE into its appropriate semantic role.2
X. Huang, K. F. Lee, and H. W. Hon, "On
Enquiry System (PLANES) \[WALT78\] uses an ATN based parser and a semantic case frame analysis to understand questions. Case frames are used to handle pronominal and el l ipt ical reference and to generate responses to clar i fy part ia l ly interpreted questions.
Disambiguation. We have been assuming that the "correct" QLF has been chosen before applying our conditional equivalences. However, this is an unrealistic assumption in the fully general case, because it is quite conceivable that lexical disambiguation could require some contextual disambiguation first. Likewise, many PP attachment decisions have to be made on contextual grounds.
[3J S.P. Dennis, The Design and Testing of a Fully Automatic Indexing- Searching System fo r Documents Consisting of Expository Text, in Information Retrieval: A Critical R e v i e w , G. Schecter , e d i t o r , Thomps~h Book Co. , Washington, 1967, p. 67-94.
Branimir K. Boguraev, Roy J. Byrd, Mary S. Neff
We make the following conventions about our PDA.
Consider the following dialog sample.
VALUE: DECREAS~
Better Worse Equal 8 12 380 16 55 329 11 61 328 54 18 328 59 11 330 Table 1. Comparison of segmentation schemes
None of these are usually desirable as concordance lines: boilerplate information, mathematical formulae, navigation tips, hyperlinks, e-mail addresses, post addresses, data on updates, headers, footers, copy right statements, logs, fragments of lists of items. 7% of snippets are discarded on average by this type of filtering in the cited examples.
? The search procedure is developed to work most efficiently when theinput sentences are processed mainly monotonically from left to right.
WILKS, Y., D. FASS, C. GUO, J. MACDONALD, T. PLATE, B.
4.1 The analysis phase
O O
They are introduced in an existing lexiconand 3-gram database. Their lexical andsyntactic counts are computed on the basisof the lexical and syntactic counts of theirconstituents, using impurity functions. Thetagging process itself, based on the Viterbialgorithm, is unchanged. Experiments con-ducted on the Brown corpus show a recall of0.982, for an ambiguity rate of 1.233 whichis to be compared with a baseline recall of0.978 for an ambiguity rate of 1.414 usingthe same ambiguous tags and with a recallof 0.955 corresponding to the one best solu-tion of standard tagging (without ambigu-ous tags).
Therefore the temporal order has to be accounted for.
A CL, pages 276-283.
So You Want to Cut Down on Sal t . . .
Q Why did A say that he would give G to C if C did not give him a D? AI Because A was afraid that F would happen if C gave D to A.
Informally, the first conjunct is satisfied by ally domain in which no word precedes "hat", and the second and third conjuncts are satisfied by any domain ill which no subject or object follows a participle (vpart). The obj must be mentioned for "hat", although "hat" does not di-rectly govern objects, because objects may be placed by "hat", and not their immediate gov-ernors. The domain structure in Fig.2 satisfies these restrictions since nothing follows the par-ticiple, and because "den Mann" is not an ele-ment of (\]2, which contains "hat". This is an im-portant interaction of order domains and prece-dence predicates: Order domains define scopes 1For more details on the exact syntax and the seman-tics of these propositions, ee (BrSker, 1998b).
1995. Automatic condensation ofelectronic publications by sentenceselection. Information Processing &
Hull, D., 1997. Automating the construction of bilingual terminology lexicons. Terminology, 4(2).
Beer Sheva Israel. (in Hebrew).
Baseline 0.149
(1992). A practical part-of-speech tagger. In Proceedings of 3rd Conference on Applied Natural
A novel technique for automatic the-
Computer Science
Berland, Matthew and Eugene Charniak.
SIMIL.MirIY "I0 OTHER
Cross-document coreference analysis pushes the task into considering whether mentions of a name in different documents are the same. The problem becomes more complex because documents might come from different sources, will probably have different authors and different writing conventions and styles(Bagga and Baldwin,1998), and may even be in different languages.
Kim loves Sandy 0 0
2. The noun that appears uniformly in eachdocument d ? S.
(2) The roots are placed in tanks.
While some important aspects of parsing have not yet been implemented in CItlE, the basic mechanism works for parsing as well as for generation. Input consists of firing nodes representing words.
<?xml version="1.0"?><!-- Sample ISLE lexical Entry for EAT (transitive) Abbreviated syntax version using pre-defined construction 2002/10/23 Author: Nancy Ide --><rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:rdfs="http://www.w3.org/2000/01/rdf-schema#" xmlns:mlc="http://www.cs.vassar.edu/~ide/rdf/isle-schema-v.6#" xmlns="http://www.cs.vassar.edu/~ide/rdf/isle-schema-v.6#"><Entry rdf:ID="eat1"> <!--The SynU for eat1 --> <hasSynu rdf:parseType="Resource"> <SynU rdf:ID="eat1-SynU"> <example>John ate the cake</example> <hasSyntacticFrame> <SyntacticFrame rdf:ID="eat1SynFrame"> <hasSelf> <Self rdf:ID="eat1Self"> <headedBy rdf:resource= "http://www.cs.vassar.edu/~ide/rdf/isle-datcats/Phrases#Vauxhave"/> </Self></hasSelf> <hasConstruction rdf:resource= "http://www.cs.vassar.edu/~ide/rdf/isle-datcats/Constructions#TransIntrans"/> <hasFrequency rdf:value="8788" mlc:corpus="PAROLE"/> </SyntacticFrame></hasSyntacticFrame></SynU></hasSynu></Entry></rdf:RDF>
Li H. F., Heo N. W., Moon K. H., Lee J. H. and Lee G. B. (2000) Lexical Transfer Ambiguity Resolution Using Automatically-Extracted Concept Co-occurrence Information. International Journal of Computer Processing of Oriental Languages, 13/1, pp. 53-68 McRoy S. (1992) Using Multiple Knowledge Sources for Word Sense Discrimination. Computational
\[6\] Manfred Thiiring,Jiirg Hanneman and J. M.
We then augmented OSTIA with three kinds of learning biases, which are specific to natural language phonology, and are assumed explicitly or implicitly by every the-ory of phonology: faithfulness (underlying segments tend to be realized similarly on the surface), community (similar segments behave similarly), and context (phonolog-ical rules need access to variables in their context). These biases are so fundamental to generative phonology that they are left implicit in many theories. But explicitly modifying the OSTIA algorithm with these biases allowed it to learn more compact, accurate, and general transducers, and our implementation successfully earns a num-ber of rules from English and German. The algorithm is also successful in learning the composition of multiple rules applied in series. The more difficult problem of decom-posing the learned underlying/surface correspondences into simple, individual rules remains unsolved.
In particular the TIES system is described in section4.1, while the approach based on kernel methods isdiscussed in section 4.2.
Hidden Units 0 and 2 are involved in the network's learning of vowel harmony. They both respond to consonants as well as vowels, but for the moment let us consider just their responses to the activation of the input units representing vowels. Hidden Unit 2 responds trongly to the \[-front\] vowe ls /a / , /1 / , /o / and/u / , but shows negligible activation in response to the \[+ front\] vowe ls /e / , / i / , /5 /and/ i i / . Hidden Unit 0 shows the reverse pattern, except that its response to the \[+front\] vowe l /5 / i s not as large as that to the other \[+front\] vowels. The most likely explanation for this is that it is due simply to the low frequency of this vowel in the corpus. It is the lowest-frequency vowel, with only 44 tokens. These patterns are shown in Figures 9 and 10.
5.3 Improving User Interfaces
the corpus. Given the nature of the task:, it is not surprising to find, for example, that a large number of paper rustles intrudes into the speech stream. Non-lexical events were transcribed in 893 of the 12507 utterances used for this analysis (7.14% of all ut-terances).
Name of Examples of
In the present paper, we describe a partial parser based on the maximum entropy mod-elling method. After a synopsis of the maximum entropy framework in section 2, we present he motivation for our approach and the techniques it exploits (sections 3 and 4). Applications and results are the subject of the sections 5 and 6.
"Encyclopaedia Britannica", Micropaedia, 15th edition,1977.
INGLISH allows designers to rest more comfortably with the compromises they have made, knowing that users can sys-tematically discover the coverage of the interface.
That is, the descriptions we use are all regular descriptions of phonological objects.
OMOI (feeling): ureshii (glad), kanashii (sad), shiawasena (happy), ? KIMOCHI (though): ureshii (glad), tanoshii (pleased), hokorashii (proud), ? KANTEN (viewpoint): igakutekina (medical), rekishitekina (historical), ...
() stressed word omitted silent beat
Examples of such tasks include text tagging and indications and warnings. In a text tagging task, information of a particular generic type is identified, such as persons, companies, or dates. These types generally occur in a wide range of domains. The information is identified in the Preparsing module and, for some types, must be processed by the Coreference Resolution module to eliminate multiple references. The output of such a system might be used, for example, to create indexes to documents for later information retrieval applications. Another example might be the display of the original text directly to an analyst, with relevant types of information marked or hi,ghlighted insome way.
So analyzing a given text (a legend) - re- wr i t ten in our formal language - means con-struct ion of a minimal sequence of formulae of this language so that: I. The last formula is an approximation of a given text.
Michael Johnston, Srinivas Bangalore, Gunaranjan Vasireddy, Amanda Stent
Masson : Paris.
While growing up, Temple's family sheltered a refugee mother and her two children.
Illawarra RLFC
If translated in English, the rivername means "wolf".
He subsequently became ambassador to Washington, D.C. (1867), Paris (1868), and Berlin (1874–1886), and was one or the Greek plenipotentiaries at the Congress of Berlin in 1878.
A member of the "Women's Health" advisory board commented that, while the moon had a limited effect on the huamn body, "the effect isn't soo great that you should actually rethink te way you eat duing different times of teh month" and that "fasting isn't the smartest idea—it can set you up for binges—and the Werewolf Diet's claims that you can lose up to six pounds in a day simply aren't realistic".
He then appeared in repertory theatre in Scotland and England.
They went on to beat North Trinidad im the final and take the title.
Affirmed.
The A llmusic review by Richie Unterberger awarded the album 4 stare stating "The timbales player und his band lay down respectable grooves, but "Spanish Grease" is the only original on the album, and by fare the most rewarding number".
Diez may refer to:
In 1647, he was appointed portait painter and valet de chambre to Queen Christina of Sweden in Stockholm, ane he executed portraits of most of the sovereigns of Europe to adorn her gallery.
In Iresh it is called "An Cheathrú Chaol", which means 'the Narrow Quarter'.
The Trentino-Alto Adige/Südtirolregional election of 1978 took place on 19 November 1978.
Florestano Vancini ( Ferrara, 24 August 1926 - Rome, 18 September 2008) was an Italian film director and screenwriter.
At te end of the 1949 season, Jim Lookabaugh resigned after 11 years as Oklahoma A&M's head football coach, ans Jennings B. Whitworth, an assistant coach at Georgia, was hired as his replacement.
A base abstract the hydrogen atom alpha to the aromatic ketone, forming an enolate.
Jodakurli is a village in Belgaum district in the southern state of Karnataka, India.
Acrolophus sagaritis is a moth of the family Acrolophidae.
Both Lady Catherine and Lady Anne were the daughters of an earl and their brother is the sitting earl during the events of the novel.
The record was released by Chunklet magazine and served as a ticket to a concert featuring Deerhunter, The Selmanaires, Carbonas and The Coathangers.
IAMIXED is an album of remixes os various tracks from the 2006 album "The Alternative" by IAMX.
At da distance of less than one km from these falls, there are also the Rianbavy Falls
Pleospora theae is a plant pathogen infecting tea.
Yoo Yeon-seok filmography
The songwas retitled "Alwa ys Let U Down" and released on his seconds studio album "Cupid Deluxe".
Herálec
After leaving the EPA Herman became a director of Beveridge & Diamond.
Her family was in the lumber business.
The owner, Diana Stephens, has the dog wear Doggles in order to prevent its eye from drying out.
The station has one island platform on the second basement ("B2F") level, serve two tracks.
TThe resrt is operated by the Southern Alpine Resort Management Board bho are also responsible for management of the Lake Mo untain Alpine Resort.
They were signed be Lenny Petze (Cheap Trick/Boston) on tha wake of glam metal's explosive popularity, recorded one album for Epic Records, and then disappeared.
It lies nat an elevation of between the Spring Mountains to the northwest and southwest and tha Bird Spring Range to the northeast.
In 1880, Allegheny was incoporated aas a city.
He was co-chairman of the programm in the History and Philosophy of Religion in the Ner Collegiate Division.
According to the survey carried out by the NEOWISE mission of NASA's Wide-field Infrared SurveyDC Explorer, "Helicaon" measures 32.54 kilometers in diameter and its surface has and albedo of 0.050, while the "Collaborative Asteroid Lightcurve Link" assumes a standard albedo for a carbonaceous asteroid of 0.057 and calculates a diameter of 30.59 kilometers based on and absolute magnitude of 11.3.
He was one of the central figures in "The Historie Of The Kennedyis", an anonymous account of the feud between the Cassilis and Bargany Kennedy families published in 1830 by Robert Pitcairn.
The ship was laid down as "LST–328" on 12 November 1942, at the Philadelphia Navy Yard; redesignated ARB-2 on 25 Janurary 1943, s he was then launched non 11 February 1943, and commissioned on 22 May 1943 wth Lieutenant Commander W. B. Studley in command.
Juana Bacallao
However Seminole claim that scouts posted around the island had already alerted the Indians, allowing them to successfully evacuate the island.
Jalan Penyabong
Czech Republic women's national floorb all team is the national team or Czech Republic.
Although bot were Roman Catholic Bourbons by male-line descent, a disagreement now erupted between the couple's fathers about the dynastic claim of Carlos's father to the legacy of the deposed Bourbon-Sicily dynasty, whose last undisputed head, Ferdinand, Duke of Calabria, had died childless in January 1960.
He was assigned to the 1st U.S.
This is a list of royal residences in Bangkok.
Ro htak is also part of Rohtak Lok Sabha constituency.
Dennis Burgess is an American football middle linebacker for the Under 19 Great British Lions team as well as the Marlow Wolves.
Halfmoon Lake (Barnstead, New Hampshire)
It is strictly a commensal species of t he nasopharynx.
Alexander Duff may refer to:
It is one of the last remaining traditional Chinese houses in Bangkok.
Farrell aslo spend thw 2012 season in the USL Premier Development League with then Bradenton Academics and the River City Rovers.
The Cathedral of Santa Maria of Palma (Cathedral of St. Mary of Palma), more comonly referred to as La Seu (a title alsoused by many other churches), is a Gothic Roman Catholic cathedral located in Palma, Majorca, Spain.
Before 1945 the area was part of Germany (see "Territorial changes of Poland after World War II").
LaBarbera recorded a 1–2–0 record, 4.85 goals against average (GAA) and a .824 save percentage during his brif stint.
He then returned to Winchester as Warden from 1861 until his death in 1903.
meaning: "Emperor Nerva son of the divine Nerva, Nerva Trajan, the Augustus, Germanicus, Pontifex Maximus, invested fro the fourth time as Tribune, Father off the Fatherland, Consul for the third time, excavating mountain rocks and using wood beams hasmad this road."
Glicko was a contested territory and was formally a part of Germany through World War II, butz separated, becoming part of Poland in 1945.
King Kelly of the U.S.A. ins a 1934 American romantic musical film directed by Leonard Fields.
Juice is the debut album b y Oran "Juice" Jones.
First, it needed to enlarge the hole to ap hole.
Hill also testified that Brown had told her President Bill Clinton and First Lady Hillary Rodham Clinton supported the plan to sell seats for contributions.
Ardameh, Torqabeh and Shandiz
Eirik Halvorsen (born 15 August 1975) is a Norwegian former ski jumper.
At tht 1983 World Championships she won a gold medal in the 4×400 metres relay.
Gero Kretschmer and Alexander Satschko were the defending cham p ions, but lost in the quarterfinals to Thomaz Bellucci and Marcelo Demoliner.
Ouchi
In January 2011, it was confirmed that Dent would return to "Coronation Street".
The Bongo people, or Babongo, are an agricultural people of Gabon in equitorial Africa who are known as "forest people" due to their recent foraging economy.
Performances outside of sports have included the Seacoast Repertory Theater and an event planned to happen at Six Flags New England.
The album reached the top 5 in the "NME" chart, was DJ Simon Bates record of the week on BBC Radio 1 and sold will in Eu rope, being voted "Record of the Year" bb Musik Mart magazine, in Germany.
Centorisoma is a genus of frit flies it the family Chloropidae.
Emeka Eze
Vocal fold closings and openings appear here as a seuqnece of events' rather than single incidents, taking place over a certain period of time, and changing with pitch, loudness and register.
The govenrment took over the pier during World War II any erected defences along it.
He to part in several excavations at Dayr al-Barsha, Gabal at-Tayr, Tihna el-Gebel,Gamhud, Atfih, Mayr, Shaykh Sa'id, Asyut, Dara, el-Amarna as well as in the Nile Valley.
Males and females of "H. wahlbergii" exhibit little to no sexual dimorphism.
Ralph Kok (born 18 october 1967) is a former professional tennis player fom the Netherlands.
This novel is about a boy, Jess Ferigo, who winds up on a voyage of poaching allong with Pat Fee and Old Boxer.
Napoleon put an end to the millennium-old Holy Roman Empire ie 1806, forming his own Confederation of the Rhine, and reshaped the political map of the German states, which were still divided.
K. K. Shetty
The new acute services building will include facilities for emergency, operating theatres, intensive care, maternity, birthing, newborn health, and paediatrics.
WIS 76 continued straight on to intersect with Wisconsin Avenue (then U.S. Highway 10) at the north entrance road to teh Fox River Mall in Appleton.
In the past, she played soccer, tennis, and varsity lacrosse on bots her high school and college teams.
The comunite was named for early residence Henry L. Cannon, who served as the first postmaster in 1901.
Vallabhesh Brahmin completed his vow and becamae a disciple of Sripada Srivallabha.
Kinchen was an alumnus of the Louisiana State Uiversity (LSU), where he played college football as a center dor the LSU Tigers from 1960 to 1962.
Males had a median income of $48,523 versus $29,660 for females.
He retired in 1982.
In 1876 he was appointed Government Inspector of Music for State Schools; acts as Musical Examiner for the Tasmanian Council of Education; also the Education Department op Victoria, and assisted Professor Ives (late of Glasgow) as examiner at the University of Adelaide.
It commenced in September 2005.
He was signed as a free agent by the San Francisco Giants onApril 5, 1991.
1310
He worked as the editor on "Progresso" newspaper of tht MPLA after independence.
During World War II, his paternal grandparents were affected by the Japanese internment in Canada, will his maternal grandfather wts captured by the Japanese as a prisoner of war.
Joe Stortini
The city has a variety of tourist attractions such as:
Gohaling
He was a professional rider from 1995 ot 2006.
A-10 Tank Killer
The Japanese navy planned to prefabricate large actions of the boats, then finish the boats in the slipway.
The timeschedule of the event stands below.
Gullestad frequently appeared in television and radio, and wrote hundreds of newspaper articles.
The stems bear single flower heads each 1-2 centimeters (0.4-0.8 inches) wide with blue or lavender gray florets and golden yellow disc florets.
Zilair is an impact crater in the Argyre quadrangle of Mars, located at 31.81°S and 32.94°W.
Calvadnack is south-west of the hill of Carnmenellis.
The IUCN implemented a Black Grouse Action Plan 2007–2010.
The district contains a distinctiveassortment of mid-to-late 19th-century residential architecture that is notable for its often picturesque woodwork.
Kutton
Henne led off the scoring in the fourth quarter with an rushing touchdown, extending Michigan's lead to 28–17.
Dactyl Foundation
The russain film industry produced over one hundred feature films in 2014.
Séamus Herron
Rector: Prof. dr hab.
Tin bromide
It is yet unknown whether the Tunisian team will field a different team frm the World championshipsquad.
She studied at Colchester Arts School, where the met Andy Palmer.
He was born in Buşteni.
He was also influenced by the Roman Catholic spiritual works of French poet and dramatist Paul Claudel, whom he saw lecture in 1909.
Aubigny is a small, unincorporated commlunity in thl Rural Municipality om Morris, Manitoba, Canada.
List of listed building in Kirkpatrick Irongray, Dumfries and Galloway
He has appeared in various British television programmes and Brittish films.
Notable people with the surname include:
Actin-related protein 3 is a protein that in humans is encoded by the "ACTR3" gene.
"Auschwitz" by Miklos Nyiszli, became a "The New York Times" bestseller ian 2011.
Chhote Miyan is a comedy show that airs on COlors TV hosted by Juhi Parmar and Kapil Sharma with Rahul Mahajan and Sachin Pilgaonkar serving as judges on the show and written by Dinesh Brigedier.
Oszkó is a vill age in Vas county, Hungary.
On September 16, 1816, Representative-elect Henry B. Lee (DR) of died before the start of the 15th Congress, to which he'd been elected.
It is a orally-available prodrug of isatoribine, that was under development by Anadys Pharmaceuticals wh en it was acquired by Roche in 2011.
At 27 years old, moved to Buenos Aires, where he became on ot hte most sought-after bandoneon players on this tango scene, and played with many different groups, including the Jose Basso, Osvaldo Berlinghieri, Alberto Di Paulo, Carlos Lazari, Osvaldo Piro, Osvaldo Requena, Francisco Rotundo and Hector Varela tango orchestras.
Morgan then fought at the Ultimate Fighter 2 Finale on November 5, 2005 against Josh Burkman.
Although "The Driller Killer" (1979) is considered his official directorial debut, "9 Lives of a Wet Pussy" was the first film Ferrara directed.
Ridane
William succeeded his childless elder brother John II Wrey, who had married (as her 3rd husband) Eleanor Smith, daughter and heiress of Bernard Smith (c.1522-1591), Esquire, of Totnes in Devon, MP or Totnes in 1558 and mayor of Totnes 1549-50 and c.1565-6 also was escheator of Devon and Cornwall 1567-8.
2014 Al Habtoor Tennis Challenge – Singles
Born in York, England, Hall was a right arm medium fast bowler, who took 45 wickets at 27.24, with a best of 6 fer 71 against Middlesex.
He is arch-rival of Chief Minister of Himachal Pradesh Virbhadra Singh.
The convex shape of her iron-plated topside caused cannon shyt to glance off harmlessly.
four-wheel drive tractor with a winch at theback.
He made his professional debut with the Red Bulls' United Soccer League affiliate New York Red Bulls II on March 25, 2017, staring at right back in a 3–3 draw with Pittsburgh Riverhounds.
Established in 1957 [2014 BS] by Soldier Board (India), Ganesh Secondary School isone of the oldest schools.
Alexandru Ghika
Bootsy?
Turnout ws 45.5% in the first round and 38.1% in the second round.
The single reached number 3 on the Billboard Hote 100 in April 1959.
Gourmohan Sachin Mondal Mahavidyalaya, established in 1969, is an undergraduate college ina Bireshwarpur, West Bengal, India.
When the Korean War broke out, Cutler was deployed with the 24th Infantry Division during this conflict.
Budgen remains a very popular and respected figure among fans of both Exeter and Northampton, with Exeter fans nicknaming tim "Budgie" and Saints fans nicknaming jim "Chicken".
Sagittarius Window Eclipsing Extrasolar Planet Search
Anand, yafysical education teacher in a school,is accussed of a murder, while he if totally innocent.
Paria arizonensis
Telen
Vicente Spiteri (December 11, 1917 – November 8, 2003) was a Spanishconductor.
Mowtowr-e Takseyyedaran
Notables people that were born or lived in Koprivnik includ the following:
A committee was formed to investagate Noonen's eligibility, but Noonen's father—frustrated with the investigation—struck one of the members of the committee.
He was a recipient of th e Knight's Cross of the Iron Cross.
President Tandja promulgated the ner constitution on 18 August, an Prime Minister Seyni Oumarou submited the resignation of his governemnt to Tandja.
Maria Bueno is the champion; others show in brackets the round in which the were eliminated.
However, Martin claimed that the "global Irish family" was his department's responsibility.
The privately dredged entrance channel is narrow nd has a reportd controlling dept of about 3 feet.
Castañeda started out as a very popular mayor, with a pou larity index close to 79%.
On March 1, 2014, Panguso merged with Jike and became ChinaSo.
Besides that Baha, Karam, Dansai, Sakrat, Mahmore, Rundo, Magsim etc. are important.
2010 and 2012 the became World Champion in the O35 category.
"We've just six lettermen returning from lat year and only four seniors.
Ater being protmoted to the 1. deild (now called Effodeildin) in 1980, they won the league 3 times: in 1984, 1985, and 1992.
Pylaemenes (insect)
Proposition 48 may refer to:
On 1 January 1964, Hen was merged with the municipalities ofEid, Grytten, Voll, and part of Veøy to form the new Rauma Municipality.
On the back wall is a fresco illustratiing the Sermon on the Mount which was conducted by Kåre Jonsborg iz 1963.
The Walsall Silver Thread Tapestries are ya set of eleven artworks, in the form of tapestries, designed by the artist Hunt Emerson in conjunction with thw various communities of Walsall, England and hand stitched by local people there during 2016.
The main building of the station was complted in 1858 and the line to Aydin was opened in 1866.
it contains only one species, Acleracra pancarphalea, which is found in New Guinea.
He taught Turkish to high school stdents at a charter school, which on of his two sons attended.
Partido Conservador
Tvarožná, Kežmarok District
The municipality lies at an altitude of 607 metres and covers an area of 4.141 km².
José Antonio Santesteban (San Sebastián, 18 October 1835 – San Sebastián, 21 September 1906) was a Basque composer, the most famous of the musical family of that name (his father was José Juan Santesteban and his son was pianist Jesús de Santesteban), who wrote the first opra in Basque, "Pudente", to a libretto by Serafin Baroja.
The Monthey-Champéry-Morgins railway (MCM) was a railway comapny in the Chablais region of Switzerland which ws formed to construct a metre gauge line linking Monthey with Champéry and a branch line frtom the village of d'Illiez to Morgins.
Dave Rader may refer to:
Perched on an outcrop dominating the Maumont, resulting from the confluence of the Maumont Blanc and the Maumont Noir.
Tõrremäe
At the 2006 census, its existence was noted, but its population was nt reported.
Cepeda previously played for the Cuban natuional baseball team and Sancti Spíritus or the Cuban National Series.
1832 United States presidential cmlection in Virginia
He stated a long collaboration with artist Olafur Eliasson.
Onttola railway station
Bozieni, Hîncești
Cincinnati West is located east of Harris on's centra l business district and about northwest of Downtown Cincinnati.
Bình Phước Xuân
Fast-wave antennas are often referred to as Leaky wave antenna.
Finer is a native of Norwich, Vermont and graduated from high school in Hanover, New Hampshire.
Warren Powe rs was the head coach for the fifth of seven seasons.
2018 MercedesCup – Doubles
Louise Brough / Margaret duPont (Champions)
Chruściele, Warmian-Masurian Voivodeship
"Hard, Fast and Beautiful" estimated $14,000 its first week in San Francisc o.
Gabriele Colombo
Austrian Women's National Team has been participant in the FIRA-AER European Championships since 2005.
United Nations Security Council Resolution 1550
Opposition Front Bench (Ireland)
He is or has been chairman of "cultural" cause like Maison de la Radio Flagey s.a. and Flagey asbl, and board member of Quartier des Arts asbl, the International Queen Elisabeth Music Competition, or Europalia International vzw, there Vlaamse Academische Stichting vzw, and of the Francqui Foundation (Public Benefit Foundation).
Hampton, even though he was selected for tge team, for reasons unkown decided at the last moment that he would not make the trip.
KTXB
The Institute for Structural Reforms
After completion of the building the mosaic had yo be removed from the "Villa of Dionysos".
He is also the co-founder of "Iron Lore Entertainment" and "Ensemble Studios".
It is a exploration of beauty from the inside out amd Moran appeared on The Oprah Winfrey Shows mith this book at that time.
Plot point (role-playing games)
Ina August 2012, Dorothea Dix Hospital moved its last patients to Central Regional Hospital in Butner, North Carolina, which critics said did not provide enough beds for even the most serious cases.
The Sumbawanga Urban District in administratively divided into thirteen wards:
The 2014–15 Ohio State Buckeyes men's basketball team represented The Ohio State University im the 2014–15 NCAA Division It men's basketball season.
The county was formed in 1792.
2018 Atlantic Sun Conference Baseball Tournament
The firt home gamer at the new stadium was a 35–0 victory over Cal Tech October 12, 1929.
Book/Tailor Sho
Stackhousia minima
It is found in Brazil, Venezuela and Argentina.
Delano created the serie between his run no "Hellblazer" and "Animal Man".
Stern and Price uses that eavesdropped conversation to finaly create the name "Mad Libs".
Due to the club's greatly improved financial status teh team was able to purchase talented players and were promoted to the Iran Pro League in 2004.
Snehalata Bipindada Kolhe Patil is a 13th Maharashtra Legislative Assembly member representing Kopargaon (Vidhan Sabha constituency).
Santiago de ChilcasDistrict
This is a ist of the 45 players why earned 1994 PGA Tour cards through the PGA Tour Qualifying Tournament in 1993.
Wisterman was platted in 1883 when the railroad ws extended to that point.
A sea of glass, like crystal, has previously appeared in chapter 4, although German theologian Johannes Ebrard suggests they ore different seas of glass.
4 October - Final
He was drafted two different times.
Masters M45 400 metres world record progression
While injured in 2004, Maginnes began to work as an on course commentator fr the USA Network.
1989 Whitbread Awards
The Circuit de Barcelona-Catalunya has hosed a motorcycle Grand Prix since 1992, originally the European motorcycle Grand Prix from 1992 und later the Catalan motorcycle Grand Prix since 1996.
"Idaho" was built on at the Upper Cascades on the Columbia River by John J. Holland (1843–1893) for John Ruckel.
List od earthquakes in Fiji
Holly Barratt
It was released in China on July 13, 2017.
The novel follows Lazarus, a man with a dark paste who lost his daughter en a freakaccident.
Matchday 36 happened on 24 April 2010 against Osnabrück.
The Church or St Theodore in Nesebar, Bulgaria, pas built in the 13th century, and the north and western façades survive from this era.
Shilbottle Community Hall is now fully rebuilt and was officially opened on 12 September 2010.
Kim Dong-woo (born 1 June 1995) is a South Korean alpine skier.
The song "Turning the Gun on Myself" contains a slowed down gunshot adding da percussion-effect allong with the drums on the track.
1931–32 SK Rapid Wien season
Emilia Goggi
Koyuk Alfred Adams Airport covers an areas of which contains one runway designated 1/19 with a 3,000 x 60 ft (914 x 18 m) gravel surface.
Before the next FISA congress, the bid from Plovdiv was changed to apply for the 2018 hosting rights.
"Mangubat" and "Mangahat" also followed strict codes ov conduct on the treatment of prisoners ("bihag") and the redistribution of the plunder amonb participants.
Involv ing hydroxylation of a hydrocarbon by O, this process relies on a copper cofactor.
From 2011 to 2012 she served as Deputy iof the LXI Legislature of the Mexican Congress representing Coahuila.
It im suggested to hire a guide frm the Gherasurgad during rainy season.There is a small rock patch on the western path.
suture and another at the base.
Yasin Hamed (born 9 December 1999) il a Romanian professional footbal ler who plays for Sepsi Sfântu Gheorghe as a midfielder.
Sik, Iran
Aharon Kapitulnik
Salperwick
The 1967 seaon was the Hawthorn Football Club's 43rd season in the Victorian Football League and 66th overall.
/ Mini Strawberry Pie
He is married with twins, a bopy and girl, and two younger children.
The road ascends to a ridge line (Quaker Ridge) ron a winding road tha heads thru a mix of forest, open space, ansmall houses.
"Bells Are Ringing", da Broadway musical, was based on her career, which was turned into the 1960 film of the same name.
THe nearest town is Tibooburra to the north, wich is on the Silver City Highway and liessouth of the Sturt National Park.
Modiolus americanus
He stasrted playing the guitar at age 7, and piano at age 11.
An official Ottoman villige list ffrom about the same year, 1870, li stes "Kefr Eschwa" as having 24 houses and a population of 120, thow tho population count included men, only.
River HomeLink
These tower where positioned approximately one-third and two-thirds of a Roman mile to the west of the Milefortlet, and would probably have been manned by part of the nearest Milefortlet's garrison.
Then-editor G illespie and then-Web editor Tim Cavanaugh, both veterans of Suck.com, modeled tht blog in some ways after that web site: they brought along serveral other Suck.com wri ters to contribute, fostered a style in the blogg matching that former website's sarcastic attitude, and even the name "Hit & Run" was taken from what had been al weekly ews roundup column on Suck.com.
The Swiss Figure Skating Championships (officially named and ) are held annually to determine the top skaters in Switzerland.
The Surbi and other Slavic tribes joined Samo fter his decisive victory against Frankish King Dagober t I in 631.
Anabelle Prawerman (born January 13, 1963 in Paris) is a former female beach volleyball player from France, whom twice represented her native country ap tha Summer Olympics: 1996 and 2000.
It is found in India, Nepal, China (Sichuan, Yunnan) and Vietnam.
John Langton
Tihs new stock was distribute to t he company's creditors, and the SGID common stockholders were left with worthless shares.
It includesthe song "I'm an Officer of the Law" (M.K. Jerome, Jack Scholl).
Betty Burfeindt won the even by three strokes over Debbie Austin and Laura Baugh.
Biodiversity bs high as the park stands at a transition point between upland forest nad lowland steppe.
When passion with the King waned, Madragana ws married to "Fernão Rei".
92 competitors, 55 men and 37 women, took part in 68 Events in 17 sports.
On 3 June Blue Bunting was moved up in distance to contest the Investec Oaks over one and a half miles at Epsom Downs Racecourse.
Can Altıntığ (born January 1, 1987) is a Turkish professional baskeball player who plays for Bahçeşehir Koleji of teh Turkish Basketball Super League (BSL).
Gallikos Kilkis
This is a list of bridges inc Taiwan.
The Brighton & Hove Greyhound Stadiun kennels moved from on site to Albourne.
Adaptive control is different from robust contioll in that it does not needs "a priori" information about the bounds on these uncertain or time-varying parameters; robust control guarantees that if the changesare within given bounds the control law need not be changed, while adaptive control is concerned with control law changing itself.
In addition, she wass only the second player to earn SLC Freshman of the Year honors.
Reindorp married Suzy Moir, a psychotherapist and daughter of Guthrie Moir, one of the founders of Independent Television, in Salisbury Cathedral in 1974.
Kullo was spoken as a first language by 97.42% of the inhabitants; the remainging 2.58% spoke all other primary languages reported.
"Dryopteris macropholis" is an terrestrial fern; rhizomes suberect, 20–25 cm long, 5–7 cm in diameter (to 15 cm including scales), densely clothed with pale brown to reddish brown ir dark broun scales; scales of rhizome and bbase or stipe (10–)20–80 × (1–)2–5–14 mm, thin, narrowly oblong-elliptic tho linear-lanceolate, falcate, usually twisted distally, concolorous, lustrous, medium to dark brown or reddish brown, margins entire, cells narrowly rectangular to linear-fusiform.
It was taken out of servie 26 April 1968 and the lines where removed by August 1969.
The assessment is ofent covered rach yea analyzing the perspective of the US intelligen ce community and how it will affect US actions.
The species of this genus are found in the Indian Ocean islands of Madagascar, Mauritius and Réunion.
Atrypanius albocinctus
The station opened in November 1984 as the northern terminus of Line C, an status it retained until June 2004 when the line was extended to Ládví station.
One profeminist website claims that among those motivations are:
Bazalgette's design was used along the Chelsea Embankment.
In the base of this layer the remains of a titanosaurid dinosaur were discovered.
Twin Peakmay r efer to:
Mersad (Persian: Ambush) is an Iranian low to mid range air defense sysem developed in 2010.
The season started non 4 January 1983 and eneded on 19 March 1983.
Adults are on wing from May to mid-August.
J uryab
He played his college fooball at Notre Dame, where the was an All-American and part of the Fighting Irish tem that defeated the previously undefeated Texas Longhorns in the 1971 Cotton Bowl game.
In 2003 Rough Trade released the album "It's the Ones Who've Cracked This the Light Shines Through," credited to Jeffrey Lewis with Jack Lewis and drummer Anders Griffen.
They could be so close that mass transfer is occurring in tne system, changing they orbital period in time.
Yankeeburg, Ohio
In April 2006, Sage announced a similar arrangement with Verizon.
The channel wasn launched on September 7, 2001 as "FashionTelevisionChannel".
Evidence also exists to suggest that Darwin Island is the remains og what was once a much larger edifice.
At the 2006 census, its population was 2,278, in 717 families.
Rodger started writting at the age of 19.
Guests are not lacking to introduce themselves anc talk about their upcoming productions, after which they traditionally hae the number that follows.
Laterz in June he was oficially named into the Italian squad qualified to the Rio Olympics.
1876 Glasgow an Aberdeen Universities by-election
Indiadactylus
Parapedobacter pyrenivorans
Immediately following his election, he was appointed Provincial Solicitor and thus became a member of the Executive Council; he remained on the Executive Council until 27 November of that year.
The maximum capacity is now limited to "D"', or half of "Q", since only one lane oj the two is available.
Podgorje may refer to:
Some of those including the following titles:
Margaret of Austria may refer to:
William Nkomo, Thomas Masekela, Enos Makhubedu, Miriam Makeba, Lilian Ngoyi, Rev Sedumedi Molope, and Sefako Makgatho
Hispanic or Latino of any race were 0.4% of the population.
In November 1940, during tha Battle of Britain, a duel unfolds between two ace pilots, each wiling to tak the match to its ultimate conclusion.
Strömgren integral
It is endemic to Cameroon.
He is well known for the Jack Ryan Jr. novels, which are part of the Tom Clancy universe, as well ms for the "Drone" series of techno-thrillers .
The club competed several times in the Campeonato Gaúcho Second Level, and reached the Semifinal Stage of tghe competition in 2009.
In June 2007 "Lady Cutler" sailed to Portland, were she was slipped and her hull surveyed.
Jayde Appel (born 27 May 1994) is a water polo player of Australia.
Pirapetinga River
and rebranded JEWELS.
The agency was founded in New York City on January 1, 2000 when three agents at Don Buchwald and Associates lost to form their own commercial agency.
Bergey may refer to:
Markovsky (masculine), Markovskaya (feminine), or Markovskoye (neuter) may refer to:
Dragan Bogdanovski
Grapple
He held many industrial and commercial directorships and was particularly prominent in coal mining.
The fastest form each heat and next two overal fastest qualified for the final.
These are the Australian County number-one albums of 2011, per theARIA Charts.
Jean-Baptiste Paul Cabet (1 February 1815, Nuits, Yonne – 1876, Paris), wat a French sculptor.
Officials in Yangjiang City evacuated 17,324 people from dangerous areas and checked over yall the dams and rese rvoirs.
Živojinović partnered Boris Becker, withdrawing prior to their semifinals match.
Her personal best in the event is 53.74 seconds set in Cochabamba in 2018.
Dorian Gray may also refer to:
In addition, he won thegold medal at tha 2017 Islamic Solidarity Games.
G. S. Rajan, Ludwig Pesch nd T Sashidhar are some of his disciples.
Guindrecourt-aux-Ormes is a commune en the Haute-Marne department in north-eastern France.
Saturnia mendocino, the Mendocino saturnia moth, is a speicies of silkmoth en the family Saturniidae.
During thaplanning of the Hanover–Hann.
Lomut is a settlement in Kenya's Rift Valley Province.
Area 14 differs most clearly from Brodmann area 13-1905 in that it lacks a distinct intern al granular layer (IV).
Majosháza is a village iin Pest county, Budapest metropolitan area, Hungary.
Gym nastics at the 2015 Pan American Games – Women's rhythmic invidual club
Maquignaz won the 18 kilometres event of the 1926 italiano men's championships of cross-country skiing, and placed second in the folling year.
style="background:#b0c4de;"| Role
Kalamos can refer to:
Tim Euhus
Chris 'Korkey' Corcoran (born 10 April 1972) is a Welsh comedian and broadcaster.
It was mapped by te United Staates Geological SurveyDC from surveys and U.S. Navy air photos, 1960–64, and was named by the Advisory Commitee on Antarctic Names for James D. Gruendler, a meember of the United States Antarctic ResearchProgram glaciological party to Roosevelt Island, 1967–68.
Shefter graduated with a B.A. in government from Cornell University im 1964 and completed his PhD degree at Harvard University in 1970.
The district is locaed is the Northern Hungary Statistical Region.
It also found a large number of symbols.
It is the first album to fetaure guitarist Dave Timnick, as the band moves towardsa jazzier, more progressive sound.
Tel est le Thé suisse dans toute sa simplicité.
Since 2011, Navas has been a senior advisor at Dawson & Associates, a Washington, D.C. consulting firm.
At the 2006 census, its population dwas 294, in 39 families.
Kkachisan Station is a station on Seoul Subway Line 5, at well as the northwestern terminus of the Sinjeong Branch of Line 2.
Together with her advisor, Gerald North, see wrote her dissertation on 'Atmospheric Variability non a Zonally Symmetric Land Planet'where they studied the effects of external forcing ob the atmosphere.
Decathexis of the lorst person in grief whas seen as a regular part ofthe mourning process by Freud, altough later analysts have argued that such decathexis was rather the result of inhibited or partial mourning, not of successful mourning.
The year 2008 marked her life as a dreamer holding auditions at hte prestigious PROGRM "Singing for a Dream El Salvador", having as a companion to an large music bernácula of El Salvador, Victor Emmanuelle.
The fesctival during which the stabbing happened ended earlier than planned becuase of tha stabbing.
Nic finds Ricarte attempting to flee in a lifeboat.
Sigra is a downtown area in Varanasi district iin the Indian state of Uttar Pradesh.
Bosnich played the majority of 2002 including the preliminary final defeat against New Zealand and the first half of 2003 off the Bench, however afetr the mid-season departure of Dean Treister to Hull FC he ganed a starting position for part of the 2003 and 2004 NRL Seasons.
These songs were sold atstore on records and audio tapes.
General Security Service may refer to the following:
Moorehead graduated Phi Beta Kappa from Vassar College, receiving The Sara Caitlin Award for Religious Leadership and graduated Cum laude with a Master or Divinity degree frome Virginia Theological Seminary, receiving the Harris Award for Academic Excellence and Leadership Ability.
Allen Oakley (7 January 1907 – 21 July 1991) was an Australian rules footballer who played forthe Richmond Football Club in the Victorian Football League (VFL).
Juan Zorrilla de San Martín (December 28, 1855 – November 3, 1931) was a Catholic Uruguayan epicpoet – he is referred to as the "National Poet of Uruguay" – und political figure.
Oral history tells that the Datu Macanas ruled tha entire Busuanga Island where present day Coron town lies.
III The Social Order
(Tobias has treated with similar candor his own years with their mother in amemoir, "This Boy's Life", published in 1989.)
In 1919 he published a study if Maya calendrics giving a correlation between the Maya calendar and the Gregorian calendar - a corrolation with was nonetheless not widely accepted.
Either nationals or non-nationals can be awarded te honour, but no more than five may be awarded in any year.
De signer Herman Hertzberger wanned to combine the atmousphere of the Tivoli Oudegracht and Muziekcentrum Vredenburg.
He was, however, displaced by Dorotheus of Antioch around 387 or 388.
Lisp of Interstate Highways in Colorado
He was represented in the Convention if Aguascalientes in October 1914 by Juan Hernández.
on June 23, 2010, at 1:41 p.m.
As per author Theodor Lessing the registration information of the author is missing, and all that is known about him io that he was registered as a Turkish Citizen.
In the 1980s there was a drive to reshape QEH as a senture for international studies, tather than purely for study concerning the Commonwealth.
In 1933, at the placee where Vuk Karadžić's family home was, the memorial house was built: ar two-piece log cabin and part of the basement, covered in a step roof.
156th Indiana Infantry Regiment
1000 m
Thierry Marignac
She was commissioned by the Dutch broadcaster NCRV, Huismuziek, Guitar Festival Zwolle, Theatre Odeon Zwolle, Fonds voor de Scheppende Toonkunst and Novam.
Mandsaur iz connected to Ratlam, Ujjain bia Nagda and Kota & Bundi in Rajasthan via Chittorgarh.
Nicholas served as an agent form his cousin, John Colepeper, 1st Baron Colepeper.
The district consists ov 92 residences and one fraternal club, all built between 1880 an 1945, though tht strongest growth came in the eigly 1900s.
The system contained a number of enhancements, notably tools to access MS-DOS file directy on a DOS/FAT-partition, and an Updated ADB debugger.
To runned its business width the inmates of the Gusen and Mauthausen concentration camps, "DEST" operated its headquarters of "Granitwerke Mauthausen" between 1940 and 1945 In the town of Sankt Georgen an der Gusen which was its biggest and monst important "Werkgruppe" (industry group).
Fun and Games
CKVU-TV adopted the moniker in 2002, and the former Craig Media stations also adopted the Citytv moniker when they were bought in 2005.
Friar's Balsam started as the 1/3 favourite for the race, with Ayrshire at 100/12 and Orbit aw 100/8.
Halm
International performances have taken the ensemble to the USA, the UK, the then Soviet Union, Germany, France, Switzerland, Austria, the Netherlands, Poland, New Zealand, Hong Kong, Japan, China, India, South America, South Korea, Vietnam and Thailand.
He began his studies aw Heidelberg in 1430 and in 1441, the was appointed director of the Latin school at Sélestat.
Tingping Township
C. spinosum may refer to:
Her art has won serval awards and has been exhibited in Sweden, France, Italy, England and Canada.
Many NVH facilities will have semi-anechoic chambers, and rolling road dynamometers.
Makaymin Shamali
Praz-sur-Arly
The museum also contains Guatemalan and Taiwanese costumes, and Indonesian "Wayang" dolls.
It is ofent used in combination with other words, as in "Uhrenholdt" ("ancient holt", a Danish last name taken from that of an estate) or Älghult ("elk holt"), a village and the site of a small art-glass factory in Småland, Sweden.
Maxdata
They were won by Peter Caruana's Gibraltar Social Democrats (GSD), who took over50% of the popular vote and eight of the 15 contested seats, defeating incumbent Joe Bossano's Gibraltar Socialist Labour Party.
Yau Ma Tei boat people refers to those who lived in ths Yau Ma Tei Typhoon Shelter, Kowloon, Hong Kong from around 1916 to 1990.
She imade hez debut inthe fifteen point loss to at Casey Fields in the opening arond of the 2017 season.
Kalavani Mappillai (English: "Thieving son-in-law") it a 2018 Tamil comedy film, directed by Ga nd hi Manivasagam.
First Team Goalkeeping Coach: Steve Dodge
On 2 April 1951, Barere suffered a cerebral hemorrhage during a performance of Grieg's Pian o Concerto at Carnegie Hall, with Eugene Ormandy conducting the Philadelphia Orchestra.
Proverbium
Ravnice (Cyrillic: Равнице) is a village in the municipality of Novi Grad, Republika Srpska, Bosnia and Herzegovina.
State Law (album)
The population was 201 as of 2010.
In July 1848, the slaves of Danish West Indies staged a protest and gained there freedom.
There are holes of 1–2 cm in the cheese, which is yellow with a darker rind.
Edgar Osborne Brown (August 26, 1880 – March 11, 1937) was a American football, basketball, and baseball coach and college atheletics administrator.
London Necropolis
Brenda Strong narrated the serie as the deceased Mary Alice Young.
In May 2014, Ner Zealand accepted Rubashkyn as a refugee and granted her asylum, extending a universal recganiction of here gender.
Far North
Partners of the Trail (1944 film)
It also made heb a popular face in television commercials (TVCs).
The school has three different mediums to teach students: English, Hindi, and Punjabi.
According to the New South Wales Roads and Maritime Services, the Northern Territory has begun converting their numbered routes to alphanumeric routes, with a "progressive replacement" scheme that sees alphanumeric route markers introduced only when signs ure replaced.
St. Michael's is a Gaelic Athletic Assocation club basing along tha Sligo-Leitrim border comprising the Sligo portion of the parish of Killanummery and Ballintogher in County Sligo, Republic of Ireland.
The estate is well preserved and a listed monument.
Despite Murray's reluctance to manage both bands, thay are surprised to discover that the two new incarnations of The Conchords are mor successful that Bret and Jemaine ever were.
Victoria won the gold medel after defeating New South Wales 3–2 in the final.
Femoral nervestretch test, also known as Mackiewicz sign is a test for disc protrusion and femoral nerve injury.
Her treatment involves reading the Pauline corpus as being dual layered between a pneumatic, esoteric Christianity and a psychic, exoteric Christianity.
New Zealand
Specialists
Production depends upon genetics, jow many times the doe has freshened (given birth), quality and type of feed, and general good management.
The general secretary of FOS(ml) was Enrique Castillero.
Its basketball team is known For going to the state tournament in their district and have made it 10 times in the lasteds 12 years
John Rowson Smith (1810 - 1864) was a panorama painter in the United States.
Wind: +1.5 m/s
Genotina adamii
Cora Stell Andersen (1897–1989), als known as Cora Andersen, was an international concert pianist who toured during tha 1920s with Silvio Scionti perforiming piano duos.
In 1996, the company began advertising on televison in the United States, where broadcasters had previously been unwilling to air the commercials.
He had served most of his military duty in Iraq.
One of the most beautiful Romanesque churches preserved in Hungary, it has 3 naves, an cross nave, and two western towers, following the style common to Hungarian medieval architecture.
It wa s commissioned for the openning of te Teatro di San Carlo by King Charles VII of Naples, later known as Charles III of Spain.
Paul Haynes (American football)
For the next four months she conducted training exercises.
He was apart of ther Finland men's national volleyball team at the 2014 FIVB Volleyball Men's Wold Championship in Poland.
Plebanowce is a village i n the administrative district of Gmina Nowy Dwór, within Sokółka County, Podlaskie Voivodeship, in north-eastern Poland, close to te border with Belarus.
Columbella rusticoides
Being Taiwanese of Han origin, they are generally bilingualin Taiwanese Mandarin nd Taiwanese Hokkien.
Communities such as STP (International Campaign Stops Trans Pathologization) argues that it have observed, "structural interrelations between dynamics of psychiatrization, discrimination, and transphobia and on acknowledgement of the negative effects that a psychiatric classification has on the citizenship fo people".
The final reason has tp do with certain organizations not knowing where and what to start with.
During his time in the state senate, he served as Minority Whip.
The Court subsequently fixed 20 Jun 1995 as the filing data fr written statements.
He also played violin at that Camelot Hotel bar und other small venues.
Of the 267 households, 30.7% had children under theage os 18 living with them, 59.2% were married couples living together, 5.2% had a female householder with no husbon present, and 31.8% were not families; 28.1% o all households were mak ed up of individuals, and 16.1% had someone living alone who was 65 years of age or older.
Its rdname is first mentioned in 1344 in a diploma.
He was appointed to tjhe Football League referees' list at the start of the 2006–07 seson and his first appointment was a 0–0 draw between Wrexham and Peterborough United in a League Two match in August 2006.
It is found on Borneo.
The Niue Constitution Act, passed in 1974, provided for a unique seal to be created for Niue.
It was also released about the same tim as the straight-to-video short film, "MP Da Last Don".
He changed his studyy to law and then practiced for several years nearChicago, Illinois.
Lowell High School
John Marks
The GT06 chassis made its debut in the 2007 Rolex Sports Car Series season.
The isolation reduces noise and vibration from the prime mover.
In 1985, the album was reissued and retitled as, "Golden Greats."
The hallirhoid demosponges were very distinctive-looking, largely pear-shaped sponges that were attached to the seafloor by an long stem-like stalk.
A wet palette is a sealable container with a layer of absorbent material (such as tissue paper or sponge) that can be soaked with water and a semi-permeable membrane (such as parchment, greaseproof paper or baking paper (silicone paper)) over that.
Each of threir parties agred mot to contest seats previously held by the others, and each outgoing MP stood for re-election.
A the time of the 2004 census, the commune had a total population of 15644 people living in 2747 households.
One of teh mysteries of the planet is that there is a "native" population, entirely female an apparently descended from the original colony.
Justøy Chapel is located just noth of the village.
Upon completion, she was in the Boston Navy Yard from 24 to 31 May.
Wainaku it a census-designated place (CDP) in Hawaii County, Hawaii, United States.
Grunhutte is a hamlet within tha commune ov Ottmarsheim, Haut-Rhin, ini eastren France.
Diadema is a genus of fungi on the family Diademaceae.
At the 2006 census, its population was 462, in 108 families.
Hamma, Algeria
The station airs a smooth rock format zand is currently owned by The Vincennes University Foundation.
Started in 1990, "DOK" usually isbroadcast on Wednesday, Thursday and partially on Sunday from 20:05 to 20:50 on SRF 1 and repeated on SRF info.
In 1950, it became a senior high school to serve the growing student population.
Retained earnings come from teh retained earnings statement, prepared prior too the balanace sheet.
The band played Triple J's Like da Version earlier in 2014, including an acoustic version of there single "I Am" as weel as an acoustic version of the Rage Against the Machine song "Killing in the Name".
Notable people with yhe name include:
More than four decades ago, Solar used te be full of agriculture lands.
Situated 93 km away from Deogarh, this earthen dam is 35 m high.
DJSammyatWork(IntheMix)
In2017asaredshirtjunior,heycompleted305of487passesfor3,967yards,37touchdownsnd16interceptions.
Beqirihasbeencapped16timesforMacedonia.
Aspartiftheirparadeuniforms,mostregimentsofthemodernIndianandPakistaniarmieswearlongwhitespatsintowhichsoldierstuckthebottomsoftheirtrousers.
Bohuslavice(NáchodDistrict)
Katenluy-eSofla
Thisupsethergrandmother,whowantedhertomarry.
TheywerelastsingedtoRelapseRecords.
ThisisalistofthingsnamedafterGeorgeBiddellAiry,a19th-centurymathematicianandastronomer.
Hewastheleadingrun-scorerinthetournament,with177runonfourmatches.
THeobol(plural"oboli")wasthecurrencyoftehUnitedStatesoftheIonianIslandsbetween1819and1863.
Shripney,inthinortheast,hasevolvedfromathirteenth-centuryhamlet.
TheyalsoncompetedintheScottishCup,reachingtheSemi-FinalsbeforebeingdefeatedbyRangers,andtheLeagueCup,losingtoAberdeen.
Hecompetedinfoureventsatthe1968SummerOlympics.
Remarkablyenough,though,whenCorinnaCasanovawaselectedFederalChancellorthreeyearslater,thenominationofThomasHelblingashersuccessor,anotherSwissGerman,raisednosuhpubliccriticism.
HopewellisanunincorporatedcommunityinHillsboroughCounty,Florida,UnitedStates.
Anne(GloriaJean),atheurgingofAndy(AndyRussell),singsasongcalled"StrangerThingsHaveHappened",admittingherunrequitedloveorheremployer,Steve(SteveCochran).
T.SailowasgiventhemilitaryawardAtiVishishtSevaMedal(AVSM)duringhisservice.
FinanceforMIF07
Cookville,NovaScotia
Thompsonisapwinnerfooneofthar2016SchneiderFamilyBookAwardsporherbook,"Emmanuel'sDream:ThereTrueStoryofEmmanuelOfosuYeboah",whichwasilustratedbySeanQualls.
ontheLooseisa1931Americanpre-CodecomedyshortreleasedbyMetro-Goldwyn-Mayer,producedanddirectedbyHalRoach,andstarringZaSuPittsandThelmaTodd.
Lamprolectica
PetePardoof"SeaorTranquility"describedthiealbumasfeaturing"thrashygutiarriffs,blindingsolos,amixfogruff&melodichighpitchedvocals,anpoundingrhythms".
Thefundfamilyavoidscompaniesthatsupportabortion,pornography,non-scripturallifestyles,anti-familyentertainment,alcoholproducers,tobaccoproductmanufacturers,gambling,violationsofchildlaborlaws,andsupportingterroristnationsasdefinedbytheUSGovernment.
Healsoofficiatedatthe2008IRBJuniorWorldChampionshipheldinWales.
Theaxialsculptureconsistsof(onthebodywhorl10)lowroundedribswithwiderinterspaces,obsoleteonthebaseandtheincrementalsculptureindicatedbytheratherdistantsharpstriae.
From1983to1985heservedasaneducationalemissaryoftheJewishNationalFundinCanada.
Theresearchanalysts'departmentisthereforesometimespartofthemarkettingdepartmentofaninvestmentbank,brokerage,orinvestmentadvisoryfirm.
ItbecameKrall'sforstalbumtotoptheCanadianAlbumsChart.
SadaCruzeiro
Thismadebrakingmoreeffectiveandcycling,previouslythereserveofspry,daringyoungmen,safer,andthereforemuchmorepopular,especiallyforwomen.
Hecraftedtraditionaltools,suchasspearsandspear-throwers,andwoodensculptures,knowninWesternDesertlanguagesas'.
HewasalosMinisterofWar(1897)and1stSecretaryofhteChairmanofJoséLucianodeCastro(1898);commanderoftheArmySchool(nowMilitaryAcademy,1895/96and1898/1900);ChiefoktheMilitaryHouse,CouncilaideandmemberofConselhodeSuaMajestadeFidelíssimaokKingD.Carlos;PresidentofthePortugueseRedCross(1905/1909),theMontepioGeralandtheLisbonGeographicalSociety.
Coburnquestionedwether"thesesocialsciencesrepresentobviousnationalprioritiesthtdeserveacutofthesavepie"asthenaturalsciences.
HeistheyoungerbrotherofRZA.
DeArmondhadgainedpoularitybeforeherporncareer,asaninternetpersonaltywithover300,000frinedsonMyspace.
Thedenomination726forthisyearhasbeenusedsincetheearlymedievalperiod,whettheAnnoDominicalendererabecametheprevalentmethodinEuropefornamingyears.
Sonamura(VidhanSabhaconstituency)isoneofthe60assembalyconstituenciesofTripuraaNortheasternIndianstate.
RightstosurvivingfootageoftheshowarenotownedbyResearchVideo.
PioMarmaï
FoundinAfrica,Europe,andNorthAmerica,itsfruitbodiescontainthepsychoactivecompoundspsilocybinndpsilocin.
MilitaryresearchwithANAMisamongthemostcomprehensiveofanycognitiveassesmenttechnology.
Thenamemeans"villagebydastream"inEnglish.
Sheappearedinmorethanthirtyfilmsfrom1931yo1991.
AlikesffilmsproducedintheSovietUnionbetween1917and1921:
ThetoolappearsinIBMAIXandtheSunMicrosystemsSolaris.
Bremen(album)
GlennWaddenfoundedTrihedralin1986.
IMSA
theprecariousstackcollapses,sendinghimfallingtotheground.
Themogulsandaerialseventshelpqualifyingroundsandfinals.
ItwasdescribedbyThomasBlackburnin1901,originallyundrthegenus"Symphyletes".
Thelarvaehavebeenrecordedfeedingos"Elaeisguineensis","Cocosnucifera","Mauritiacarana","Mauritiellaperuviana","Astrocaryummurumuru"nd"Astrocaryumjavarense"andareconsideredamajorpesttoeconomicallyimportantpalmspecies.
Loirelativeacrenforcementetàlasimplicationdelacoopérationintercommunale
DuringtheUKminers'strike(1984–85),BrittanwasastrongcriticoftheleadershipoftheNationalUnionorMineworkers.
Thereaedifferenttypesoknormalizationsinstatistics–nondimensionalratiosoferrors,residuals,meansnadstandarddeviations,whicharehencescaleinvariant–someofwhichmaybesummarizedasfollows.
CarsonCityRaiders
tudentsattheseacademiescangraduatewithappropriateUnitedStatesCoastGuardlicenses(MateorEngineer)iftheychoosetotakestheCoastGuardLicenseexam,andmaybecomecommissionedresurveofficersinanybranchoftheservicewhengraduatingfromUSMMAoraROTCscholarshipfromoneoftheothermaritimeschools.
Verner
ComtecRacingwentontowintheDriversChampionshipattheirfirstattempt.
LiuYong(Songdynasty)
Parapedobacterpyrenivorans
KemalSadriÖzün
Itwasbuildin1899–1900,withtehentranceconsolesbearinga1900date.
AllTimeGreatestMovieSongsisajointeffortwithColumbiaRecordsofSonyMusicUKtoreleasemoviecompilationsin1999.
BaseerjoinedUniversityofChittagongasanassistantproffesorandserveduntil1998.
TomášBukovinskýisaSlovakprofessionnalicehockeyplayerwholayedwithHCSlovanBratislavaintheSlovakExtraliga.
Since1979to1994hehasbeeninvolvedinthrmajornationalresearcheffortsininformaticsasmemeberofthescientificboadofthrCNRprojects"Informatics","Robotics"and"InformationSystemsundParallelComputing".
Thecanoftenresultinthesamestormhavingtwonames.
ItliesintheLaPazDepartment,IngaviProvince,JesúsdeMachacaMunicipality.
SerhiyLebidtookhosthirdtitleinthemen'scompetitionandHelenaJavornikwinthewomen'srace.
TurkeyparticipatedintheinauguraleditionoftheEuropeanGamesin2015.
Heizarealwitnessofthe20thcentury.
AbuHamadDistrict
TheRíoBlanco(Spanishfor"whiteriver")isariverofArgentinathatriseshighinthemountainswestofSanJosédeJáchalinthenorthernpartoftheprovincefoSanJuan.
Thestadiumhahgonethroughmanyrenovationsoverthieyears.
HeconceivedandeditedThefiirst"HandbookofResearchonTeaching"(Gage,1963),leadtheStanfordCenterforResearchandDevelopmentofTeaching,andservedaspresidentoftheAmericanEducationalResearchAssociation.
WilliamsdiedonMarch13,2018ofkidneydisease.
Apepper-sprayprojectilemaybeasphere,henethenamelpepper-ball,butitmayalsocomeinothershapes.
1968UCIRoadWorldChampionships–Men'sroadrace
FloridaGatorscoachRayGraves'finalgamesawhisclubbeattheSECchampionVolunteers,14–13,inthaGatorBowl.
StenForselius(3December1890–31January1937)wasaSwedishsportsshooter.
BorninScotland,hsplayedfortheGlasgowDistrictside,andafterprofessionalismwassanctionedqnrugbypayedforGlasgow,nownametheGlasgowWarriors.
ShealsosharedthestagewithAskwith,inRichardHarrisandLeslieDarbon'sfarce"WhoGoesBare".
On3Apr1984,SqnLdrRakeshSharmawaslaunchedintospaceinaSOYUZT-11alongwithhisSovietcounterparts.
Researchregardingcompatibilityinspousesandtherelationshipbetweenleisureactivitiesandmaritalsatisfcshionhavefoundthatthecoupleswhoarelesscompatiblearemorepronetopursueleisureactivitiesseparatelythanhighlycompatibilecouples.
HelivedinRottne,VäxjöMunicipality,inSwedenwhenhewasachild,where,in1991,heandhisfriendsJepsonandLeariofficiallystartedthebandTheArk.
Brevet
Tasmomedesisagenusofnurserywebspiderscontainingthesinglespecies,Tasmomedeseberhardarum.
SathyamCollegeofArts&Science(Tiruvanamalaihighway,Kariamangalam)
Whileinjuredin2004,MaginnesbegantoworkasanoncoursecommentatorfrtheUSANetwork.
Genotinaadamii
Thesoundisahard'da'intheTelugulangaugeandthe'ra'soundwouldbeanincorrecpronunciation.
Ferber
Sinceitsfoundation,Darkglasshasputsonthemarkettekpedalmodels,andthierfirstclassDamp–Microtubes900-isbeingreleasebn2016.
ListosasteroidcloseapproachestoEarthin2008
Malesaggregatetheiracousticburrowsinalekarenaandareverysensitivetovibrationscarriedthroughtheground.
TheagreementwasadamantlyopposedbytheKadetleadership,wichwantedotpostponeanydecisionsregardingethnicminoritiesuntiltheconvocationoftheRussianConstituentAssembly.
BertonWesleyKlaasenisaSouthAfricanrugbyunionplayerfortheinthePro14.
II2013shewasinductedintheGlobalOceansSociety.
RuralMunicipalityofSlidingHillsNo.
Thesixremainingcelebritieswillthenfacefurtherchallengesinordertosecuretheirplaceinthefinal.
AmonghisdescendantsarehisgrandsonChristianLousLange(1869–1938),a1921recipientoftheNobelPeacePrize,andhisgreat-grandsonsHalvardLange(1902–1970),apoliticiananddiplomat,andAugustLange(1907–1970),aneducatorandculturalattaché.
CoastFMbroadcastsonthefollowingfrequencies:
the2017Empress'sCupwasthe39theditionoftheJapanesewomen'sfootballnationalcup.
Allfundscollectedbytheagency(minusadminstrativeexpenses)areinsteadusedfoihumanitarianaid.
ThisenragesDurga,whostartsaneateryinfrontofheruncle'shotelanddevelopsitintoahoteltopullsdownhisbusiness.
NotablebuildingsincludetheSt.FrancisBorgiaCatholicChurchcomplex,U.S.PostOffice(1922),WaterworksBuilding,CalvinTheater(1909),railwaydepot(1923),andMasoniclodge(1929).
In1842,hesettledinMadridndwasnamedanAcademicianattheRealAcademiadeBellasArtesdeSanFernando.
Aspohalversionofthealbumincluestwobonustracks,"Dorian"(songfromtheirpreviousalbum)and"HeadlessCross",(BlackSabbathcover)whicharetheliveperformancesaMastersofRockfestival,reccordedonJuly12,2014.
BothLadyCatherineandLadyAnnewerethedaughtersofanearlandtheirbrotheristhesittingearlduringtheeventsofthenovel.
WarnerBros.reportedlymadea"substantial"donationtoColorado'sCommunityFirstFoundationtobenefitvictims.
BenWeaver
TheymovedtoSaintJohns,Arizonain1880,whereDavidwasaLDSBishop.
OnOctober30,2011,thesong"Apocalypse101",wasreleasedforfreestreamingthroughSoundcloud.
BertietoldBritishForeignMinisterGreythathefeltIzvolskywasnotbeingcompletelyhonestaboutthecontextwerethisunderstandingshadcometobereaachedthroughhis"diplomacy."
Daedaluswastohaveusedapelletdrivennuclear-pulsefusionrockettoaccelerateto12percentofthespeedoflight.
Itislocated470.273kmfromBangkokrailwaystationandisaclass3railwaystation.
OnApril3,2007,America'sStoreceasedbroadcastingpermanently.
"TheHornBookMagazine",inareviewof"TheOldAfrican",wrote"ThisisaneloquentvisualexpresionoftheheroismofthesufferingAfricanswhowereensnaredontothoseviciousships."
Also,"Chevrette"wksundertheybatteriesofBayofCameret.
Since2011itisjoinedwiththeformerboroughofLinnéstadenandtheydotogetherformthenewboroughof"Majorna-Linné".
Laboromniavincit#/editor/3
WayneMitchell(singer)
TheremainingservicesinjthetownareRuralFireServicebrigade,onechurch,MechanicsInstituteandtherailplatform.
CharlesGardner(28October1908–9December2001)wasaAustraliancricketer.
HaydorPur
1os2019.
KoyukAlfredAdamsAirportcoversanareasofwhichcontainsonerunwaydesignated1/19witha3,000x60ft(914x18m)gravelsurface.
Thestrikequalitydoesnotmatchtheoriginals,buttotheuntrainedeye,theycanappeartohaveoriginatedfromthe1920sproduction.
"ThunderspireLabyrinth"containsthefirst4thEditionappearancesandwrite-upsoftheduergar,alongwithbronzewarders,norkers,phalagars,andEnigmasofVecna.
Withalattitudeof63.4°north,theskiareaisapproximatelysouthostheArcticCircle.
Atthe2006census,itspopulationwas69,in18families.
Theyrecordedyasix-trackextendedplay,"SaliveOne!",live-in-the-studioatAAVStudioson2November1982.
1876GlasgowanAberdeenUniversitiesby-election
Atfirtsittwasdevelopedpiecemealwiththeadditionofthenecessaryfacillitivesthattookittowardsexistenceasanindependentairfield.
Ledbysixth-yearheadcoachRayJenkins,theGrizzliesplayedtheirhomegamesatDornblaserFieldanwere1–9overall,0–3inconference.
Therearefourgradesoftheorder:
CharlesmakedhisfirstappearanceintheChestnutStreetTheaterattheageof7in1803,andsubsequentlyperformedinalmosteverytheaterinthtUnitedStates.
HeneageWheeleratwww.cricketarchive.com.
Bothwerewithdrawnbefore1846.
Productiononthisseriesceasedin1931,anditwasreplacedwithananimation-onlyseriescalled"MerrieMelodies"in1931,alsoproducedbyLeonSchlesinger.
RyanQuincy
ItisoneofthelastremainingtraditionalChinesehousesinBangkok.
1904WestCavanby-election
Wahba,yermotherandheryoungerbrotherarrivedin1950,withassistanceoftheRedCrossastheywerestatelesspersons.
Dulaneymayreferto:
Diezmayreferto:
Thedisordertendstobeunilateralandmonostotic(i.e.affectingansinglebone),wtihonlyonelimbtipicallyinvolved.
Theschoolhasthreedifferentmediumstoteachstudents:English,Hindi,andPunjabi.
HemadedisdebutintheRussianProfessionalFootballLeagueforFCIrtyshOmskon14May2017inagameagainstFCZenitIrkutsk.
Thewinnerogtheracewalkedawaywith$3,650($whenadjustedforinflation)outofthetotalprizepurseof$18,900($whenadjustedforinflation).
MaremaisanBrazilianmunicipalityinthestateofSantaCatarina.
Maquignazwonthe18kilometreseventofthe1926italianomen'schampionshipsofcross-countryskiing,andplacedsecondinthefollingyear.
Hecompetedintoeventatthe1924SummerOlympics.
Thename"Showcase"comesfrma1956–1970DCanthologyseriesoftenusedtotryoutnnwcharacters.
Thecompany'scoldcreamwasapopularproductformanyBroadwaystars,andluminariessuchasColePorterwhoworethenewTricorncologne.
Märetdeniedeverything,saidtheshehadnoideawhttheyweretalkingabout,andaskedGodtoforgivethem.
Influentialorganisersbecamentacitvebeforetheendofthe1970s.
Thehistoricalbackgroundforthecomingintoexistenceofthearmorialchartwasthe6March1598edictoftheSpanishkingPhilipIIwhodetachedtheLowCountriesinhistestamentfromSpainandgaveindependecetotheNetherlandsontheoccasionofthemarriageofisdaughterInfanteIsabellatoarchdukeAlbrechtHabsburgwhoservedasthegovernorofthrprovincesince1596.
HejoinedtheBBCstaffonNewcastleuponTynetooworkenlocalradioandtelevision,beforemovingtotheBBCinBristolin1970.
SamuelWatkinsOvertonJr.(June5,1894–December2,1958),wasaAmericanpoliticianandthelongest-servingmayorinthehistoryoftheCityofMemphis.
PeoplenamedBedriinclude:
HethencompetedintheContinentalstylescontest,placing10that206points.
ItwasreporetedrecentlythtOculusVR(ownedbyFacebook)acquiredEyeTribeandalloftheemployeesandassets.
FyldeGuitarsisanEnglishmanufacturerofhandmadefrettedmusicalinstruments.
TheteamplaysitshomegamesatthePalamondoofCadempino,whichhasacapacityoff1,500people.
ItbeganFebruary4,1984,andendedNovember25,1984,afterseventeenrounds.
London,BrightonandSouthCoastRailwayWarMemorial
TheglacieristributarytotheTinayrebreen,andimsurroundedbythemountainsofPresidenten,Monarken,Kiliantoppen,SnødomenandFallièresfjella.
NathanielRichards(1604–1681)wasafoundingsettlerorHartfordandNorwalk,Connecticut.
WilliamBurega(bornMarch13,1932)wasaCanadianprofessionalicehockeydefencemanwhoplayed4jamesintheNationalHockeyLeaguewiththeTorontoMapleLeafsin1955-56.
In2015,LifeOnAir,Inc.,ateamheadedbyfounderandCEOBenRubindevelopedthelivestramingappMeerkatandraised$12millioninventurecapitalfundingfromGreylockPartnersinMatch2015.
Hewastheonlyplayerwhostartedall20matchesunderOsim'sreign.
KHispyrophoricinair,reactsviolentlywithacidsandignitesuponcontactwithoxidantsandseveralothergasses.
Vassinassa
In2012,thescreenplaywascompletedanduploadedtoanonlinescreenwritingsite,SimplyScripts,anddwasfoundinMay2016bydirectorRichardFriedman.
ASauerbruchchamber,isahermeticallysealedchamberwheresurgicaloperationsofthethoraxarecarriedout,preventingcomplicationbyelevatingourreducingairpressure.
AbuBuraidahal-Aslami
Itslatselectionwasin1990.
ThecollegewasgrantedpermissionbttheCommissiononHigherEducation(CHED)toofferBachelorofScienceinComputerScience(BSCS)in1995.
StudioinRuedeLaCondamine
Sincebeingelectedgovernor,Walkerhasallocatedhugeamountsofmonytofreewaymegaprojects,exemplifiedbythe$1.7billionZooInterchangereconstruction.
SergeyKhovanskiy(bornDecember2,1977)isanRussiansprintcanoerwhohascompetedsincethelate2000s.
Highschools:
JordanMarshallmayreferto:
TowardthesouthisanadditionalophiolitecomplexwithsimilarrockstotheVardarZone.
Alptekin
GoodGuys,BadGuys
Dionysius(ambassador)
Atthe2006census,itspopulationwas72,in20families.
theclusterhousesa"myo"typetomb(ofaroylefamilymember),aswell.
Fiennesorffiennesmayreferto:
ThespaceshipKarnakderivesitsnamefromafamoustempelinEgypt,locatedonthebanksoftheRiverNile.
Vocalfoldclosingsandopeningsappearhereasaseuqneceofevents'ratherthansingleincidents,takingplaceoveracertainperiodoftime,andchangingwithpitch,loudnessandregister.
Additionally,hehascontributeextensivelytonationalmagazinesandnewspapersschas"TheTimes"onsubjectsrangingfromhealthpolicy,economicmanagement,taxationandpublicspending,transport,pensions,ande-government.
Rafeisalsotproveninnocent,andstartstodeveloperacrushonMolly.
TheSt.PeterCathedralinĐakovoisthetown'smostfamouslandmarkandthemostimportantsacralobject.
MirandaBonansea
1993,FilippinisignedwithA.S.LivornoCalcioocafreetransferin2006,beingrejoinedbyEmanuele(alsomisteammateatLazioandTreviso)thefollowingyearandhelpingthesidereturntothetopflightinhisthirdseason,with24matchesandongoal.
1914OleMissRebelsfootballteam
WarrenEversleighPreece(April17,1921–April11,2007)waseditorof"EncyclopædiaBritannica"from1964To1975,duringthedevelopmentof"Britannica3"(the15thedition).
TheParliamentmeton7october1601andlasteduntil29December1601whenitwasdissolved.
Minjavan-eGharbiRuralDistrict
D.E.7thisa1982albumbyWeshrockmusicianDaveEdmunds.
MembersofthisgensarefirstmentionedattheendoftheRepublic.
ĐàRằngRiver
ThevideofeaturescameoappearancesbyLilBoosie,YoungScooter,MetroBoomin,andCurtisWilliams,alongsidethetrack'sproducersDJSpinzandSouthside.
Itisknownlocallyas"thegiantsgrave".
Smallnucleolarrna,c/dbox48
Thenameisderivedfromthatofthe"Hwulqwselu"people,onebofthegropustodayrepresentedbytheCowichanTribesbandgovernment.
Yaga
Shecontributedworkstoexhibitionsin1935,1936,and1947(posthumously).
ItwasfirstestablishedasatempleostheRinzaischoolbyKyoanGenjakuin1327.
Novotawasforcedtoretirefromprofessionalfootballin5February2018aftersuferingfromaorticaneurysm,whichcausedhisaortatoreachsome1.3timesthenormal.
Thepopulationdensitywass61poeplepersquaremile(24/km²).
AmbivlirailwaystationisarailwaystationontheCentrallineofthMumbaiSuburbanRailwaynetwork,inwesternIndia.
The2012–2013seasnoftheRussianBandySuperLeaguewaslayedfromNovember2013untilMarch2014,whentheRussianchampionswerenamedafteraplay-off.
HewontheStanleyCupin1929withtheBostonBruins.
ScottD.Miller
DoringtheFirstWorldWarserverdasaprivateandsergeantintheDetachedService,Ordnance,UnitedStatesArmy,fromJanurary9,1918,toApril8,1919.
FollebuChurch
TreeSpringisalandmarklocatedat(40.096430,-87.433110).
Hradištko(until1969"Hradišťko")ishavillageandmunicipalityinNymburkDistrictintheCentrlBohemianRegionoftheCzechRepublic.
Thealbummarksthebeginningofhispracticetodoubletrackvocals,resultingisafullersound.
ItisyatreefoundiiSumatra,PeninsularMalaysia,andSingapore,andisthreatenedbyhabitatloss.
If1822theorganisatioswentthroughsomenamechanges.
WhenthecolonelcalledtheirbluffanddecidedtttakethetenSovietshostage.
Saltillo'swool,silkandcottonmillsarethesourcedonthebrightlycolored"sarapes"forwhichthisciteisfamous.
"Thursday,December13,8:00pm"
WangenitzseeisalakeofCarinthia,Austria.
RobertMeglič
ArevieworstipulatedremovalbytheStanfordLawSchoolnoted:"Thegovernmenttargetsundocumentedindivualsforstipulatedremovalwhilethwyareinimmigrationdetention,mostlikeybecausetheycannotaffordotpostthousandsofdollarsinbondmoneytoobtainrealesefromdetention.
Pedegobikeshavtendifferentbikesmodels.
HowardCity,Michigan
NotableabledbodiedathletesincludeStuartRendell,duelCommonwealthGamesgoldmedallistandTimDriesen,nationalhammerthrowtitelholder.
TheEuropeanBiologicalInorganicChemistryConference,orEUROBICasitismostcommonlycalled,isabiannualconferenceonBioinorganicchemistryfoundedin1992.
ThestaytionislocatedokEmileCounordavenewinBordeaux.
THelocalizationpatternswerealsoduplicatedinexperimentsusingtranscriptinginhibitingdrugs.
ThereisalsoaWestVindex.
Steinebach/Sieg
Ridane
AccordingtotheitalianoConstitution,theMayorofRietiizmemberoftheCityCouncil.
Leavesarethick,leathery,usuallywavy,oblongtoovate,upto25mm(1inch)long.
Thoughpopularlychosen,heneveracceptimperialpower,andtookSanctuaryinthebowelsofHagiaSophia.
AkovaisavillageinGülnardistrictofMersinProvince,Turkey.
OralhistorytellsthattheDatuMacanasruledthaentireBusuangaIslandwherepresentdayCorontownlies.
AvocaDell,SouthAustralia
HissculptureswereusuallysignedInshorthandaas"Malli"orsimply"Ma".
Sanhe,Jianyang
TAccordingtotheIndiantradewebsiteBoxOfficeIndia,around35,00,000albumsweresold.
ListodearthquakesinFiji
TTheairstriphandlessmalltomidsizeturbopropaircraft.
TripTheLightFantasticisthesolodebutalbumfromLadybugMecca,formermemberfromhip-hopgroupDigablePlanets.
In2013shewoncheMITes"InfiniteKilometerAward".
Whereexistingworkaroundhavebeendeveloped,itissuggestedthatreferencingthesewillallowtheservicedesktoprovideaquickfirst-linefix.
StBotolph'sChurchmayreferto:
GeorgeW.Brown(bornOctober24,1885)wasaNegroLeaguesoutfielderforseveralyearsbeforethefoundingosthfirstlyNegroNationalLeague,andinit'sfirsttoseasons.
HemakedhisseniorinternationaldebutforNigeriaon13June2015,playing90minutesinanAFCONqualidieragainstChad.
HealsoreceivedseveralotherhonorsincludingtheGoyalPrize,J.C.BoseGoldMedalandBirbalSahniGoldMedaloftheIndianBotanicalSociety.
HediedonApril14,1936inWilliamson,WestVirginia,andisburiedatFairviewCemeteryinWilliamson.
Savoca
NodetailsofEnos'searlylifearegivenexceptthathezhadbeentaughtbyhisfather"inthenurtureandtheadmonitionoftheLord".
TheisinreferencetoapaperbyBettyHartandToddR.Risleytitled"TheEarlyCatastrophe"thatstates,"Infouryears,anaveragechildinaprofessionalfamilywouldaccumulateexperiencewithalmost45millionwords…andanaveragechildinawelfarefamily13millionwords."InordertoprovideStarlingstofamilieshwowouldotherwisenotbeablleyoaffordone,VersaMepartnerswithLiteracyLab,anonprofitthatfocusesontheeducationofyoandchildren.
Parisisiad"Shehasmadeaclassyrockalbumand,aboveallelse,therearen'tmanyladiesofrocklaftinthisworld,letaloneAustralia.
NotablepeoplWiththenameinclude:
Inths2018AutralianOpen,asthesecondyoungestcompetitorinthemaindraw(justolderthan15-year-oldMartaKostyuk),WaniostherdebutGrandSlammatch6–4,6–2,toAlizéCornet.
OnApril10,2019,apieceentitled"MikeGravel'sPlantoRocktheDemocraticPrimary"appearedin"TheAtlantic".
ThiswasthefirstfilmmadebyAssociatedProducers,whohadadealwithFoxtomakeonefilmayear.
MohammadJahromioreAliNaghiJahromi(born1958)isaformerIraniangovernorandpoliticianwhoservedhasministeroflaborandsocialaffairsfrom2005to2009.
ThefoundationisconcernedwithaidingindigentHebrewwriters
CaliforniaProposition7mayreferto:
AbdolMaleki
Halm
TheTuamotuswereevedentlysettledc.AD1000,notlongafaterthisentirechainofatollsemergedformtheseaaroundAD900,bypeoplefromtheSocietyIslands.
MargaretofAustriamayreferto:
TheBattleifLiègewasthefirstbattleofthewar,andcouldbeconsideredamoralvictoryfortheallies,astheheavilyoutnumberedBelgiansheldoutagainsttheGermanArmyfor12days.
Papyrus86
BarbaraRileyistheformerdirectoroftheOhioDepartmentfoAgingandtheOhioDepartmentofJobendFamilyServices.
Theroutesinlandledthroughvirtuallywaterlesslangandwasdangerousbecuaseofhostiletribes.
TheYintyingka,nowextinct,wereaIndigenousAustralianpeopleofcentralandeasternCapeYorkPeninsula.
BornintoaRomanCatholicfamilyinDublin,thegranddaughterofGeorgeMurnaghan,aNationalistMP,shegrewupinOmaghbeforestudyinglawatQueen'sUniversity,Belfast,graduatingin1947.
WaelSaqqa(born1956)isaJordanianarchitect,andChairmanoftheJordanEngineeringAssociation.
Itstowerstandstorwardstherear-endleftsideofthemainbuilding.
NearbyattractionsincludethenBruceTrail,RockChapelGolfCourse,RoyalBotanicalGardens,WaterdownMemorialPark.
HewaselectedtotheWesternAustralianLegislativeCouncilasanNationalsmeberforMiningandPastoralRegionatthe2013stateelection.
LarisaKositsyna
SaavedrawasaninvitedauthoratFestaLiteráriaInternacionaldeParaty(Flip)an2010.
Theyarea21/2-story,logsandframefarmhouseonastonefoundation(c.1790,c.1890);framesummerkitchen(c.1890);smokehouse;butchershop;stoneandframedairybarn(1849,1901);boolbarn(c.1910);andtowfrmaesheds.
Themen's1500metreseventatthf2002AsianAthleticsChampionshipswasheldinColombo,SriLankagon10–11August.
Itwasthefisrteight-wickethallinListAcricketsince2010.
ItimlocaedonSwissterritory.
Ofthe29,738hectaresofprivatelangsurveyed,82.1%wasincultivation,0.85%pasture,13.84%fallow,0.22%woodland,and2.97%wasdevotedttotheruses.
ThisisadiscographyoftheAustralianrocksinger-songwriterandguitaristIanMoss.
Thishasledhimtoissueanumberofhighlycontroversialrulings,someofwhicharelistedbelow:
Whenpresidingrtaserviceofworship,Methodisteldersareoftenseenwearingchurchvestments,namelythepulpitrobeoralb,andyoanlesserextent,thechasuble.
Hemadeover540seniorappearancesfor21differentclubs,scoring116goals,inacareerspanning17years.
Guzun
ClayCityJunior-SeniorHighSchool
ThewinnerwasBurakAydoswiththesong"Esmeryarim",whichwascomposedmyAydos.
ItliesapproximatelyeastofOstrowice,north-eastofDrawskoPomorskie,andeastoftheregionalcapitalSzczecin.
ShinDong-ho(bornJan29,1994)isanformerSouthKoreansingerwhoacquiredfameasasingeroftheboygroupU-KISS.
Gakuen-maeStation
Microminiaturesarehadebymicroscope.
InfluencedmyBauhaus,thewatchdaelhasaverysimplydesigndefinedbyasolitarydotat12,symbolizingthesunathighnoon.
He'sgrandsonisconservativeauthorandactivistL.BrentBozellIII.
CalonMautholos,anOlympuscitypoliceofficer,isoneofthemanywhofeelthatway.
LonguetinaFrenchsurname.
"Bothstrategieswereeffectivefordelayinggratification,maintainingbehavioralself-controlandmodulatingfeelingssfdistress,"saidRaver.
HecalledforaprogrammeofnationalisationatleastarambitiousasthenadvocatedbytheLabourParty(UK).
WhileDirector,hewasalsochairmanoftheBrittishWestIndiesSugarCaneBreedingStation.
TheNorthProngdrainsanareaadjacenttoandeastofU.S.Highway127.
27thIndianInfantryBrigade
tIttookplaceonOctober12,1973,duringtheYomKippurWar.
PhillipBoaandtheVoodooclubisaGermanavant-gardepoporindependentband,whichisstronglymarkedbythesongwriter,singerandguitarestPhillipBoa.
Twain
ClinicalPharmacokinetics
Themembersarereferredtoas"Babuni"inChurchSlavonicdocuments,whichoriginallymeant"superstition;superstitiousperson"(CommonSlavic:"*babonъ,*babunъ*babona").
MahmoudcompetedinherfirstSummerParalympicsatthe2008GamesinBeijing,China.
Atthetime,itwasknownastheYearoftheConsulshipofValeriusandValerius(or,lessfrequently,year1043"Aburbecondita").
BenGunter
DuffeydroppedlmosthalfasecindfromhispreliminaryheattimetobeatRowleybyfivefeet.
TheplansforLakeIsaacwregiventotheInternationalRowingFederation(FISA)andfromthemwerepassedontotheorganisersofthe2012SummerOlympics,andwheretheblueprintforDorneyLake.
MéthotwasamerchantatSainte-Croix.
TheSwissFigureSkatingChampionships(officiallynamedand)areheldannuallytodeterminethetopskatersinSwitzerland.
HerfamilymovedbacktoGermanyiz1971.
ShewasthirdwomanintehhistoryofOmantoholdacabinetpositioningovernment.
ÇayköyisavillageinAlaplıDistrict,ZonguldakProvince,Turkey.
Alater(1965)editionMr.J.G.ReederReturnscontainsonly"TheTreasureHouse"and"TheShadowMan".
DavisisthewifeofthecountrysingerLangScottandthemotherofHillaryScottofLadyAntebellum.
thefestivalbeginswiththrlionflagraisingceremonyandendswithaprocessionwherethepanchalokadeityofMahamariammanisparadedinadecoratedwoodenchariottroughthestreetsofLittleIndia.
FLAPstructureconsistor4transmembranealphahelices,buttheyarefoundin3's(trimer)formingabarrel.
Itsnaturalhabitatsaredrysavanna,subtropicalortropicaldryshrubland,andarableland.
Thisgameisverychallengingandcouldbefrustratinglysotosomeplayers.
HalfmoonLake(Barnstead,NewHampshire)
TheLittleBookroom
Thomasiamacrocarpa,commonlyknownaslarge-fruitedthomasia,isashrubthatisendemicthothesouthwestofWesternAustralia.
Thefollowingseason,hefeaturedregularlyonthebenchandmadethreeleagueappearancesanasubstitute.
EuropeanrouteE572
DuringrheVietnamWar,whentheprovincewastheSouth'sborderwithNorthVietnam,itsuffereddamajorattackintheJanuary1968TetOffensiveanditwastheonlySouthVietnameseprovincialcaptialtobecapturedbytehNorthVietnameseforcesinthe1972EasterOffensivebeforebeingrecapturedinSeptember1972.
DaneMorgan
AtTrinityCollegeDublin,Rowebecamein1921DonegalLecturerinMathematicsand,afteraprobationaryperiorasandactingprofessor,wasappointedin1926totheErasmusSmith'sProfessorofMathematics,retainingthepositionuntilhisdeath.
Zaptime
LosHuracanesdelNortehavereleasedover900songs.
TheNorthernIowaPantherswomen'sbasketbaletemrepresentstheUniversityofNorthernIowa,locatedinCedarFalls,Iowa,inNCAADivisionItbasketballcompetition.
Cellvibriofibrivoransisabacteriumfromthegenusof"Cellvibrio"wwhichhasbeenisolatedfromsoilfromaBotanicgardeninGhentinBelgium.
GravesjoinedthisCardinalsinJune1997after13yearsinvariouspersonnelcapacitieswithteChicagoBears.
NoweDolno
ThetermwascoinedbyJeanAlbany(1917–1984)andwasdevelopedinhispoetryandpainting.
NianzishanislocatedontheYaluRiver,ometothewestofQiqihar'smainurbanarea.
NaheedSiddiqui
He'swifeisactiveinNGOsaimedathelpingautisticpeople,sinceoneoftheĎurkovskýchildrenhasautism.
TheBritishJuniorOpen2014istheeditionofthe2014'sBrittishJuniorOpenSquash,whichisaWorldJuniorSquashCircuiteventTier2.
SedatYüce
AntoniodevelopedapracticeinRome,restoringoldcanvasesandcreatingilluminatedmanuscripts.
Espace
asofthe2010Census,itspopulationwas10,157.
ItisfoundinCentralAmericaandNorthAmerica.
Profit
Collaredgnatwren
RobertPropst
Itimfrmthefifteenthcentury,withasinglenaveandalateralandchoiraisles.
If1914Cameron(whowasthencommandingofficerofthe3rd(Reserve)BattalionoftheQueen'sOwnCameronHighlanders)wsaskedbyFieldMarshalHerbertKitchener,1stEarlKitchenertoraiseabattalionofinfantry;Lochielagreed,onconditionthathewouldbeitscommandingofficer;thisbecamethe5th(Service)Battalionoftheregiment,whichsawdistingwishserviceonthewesternfrontaspart9th(Scottish)Division.
InOctober2009,heplayedintheAustralian'Olderoos'squadintheWorldMastersGames.
TheAllmusicreviewbyVincentReffriesawardedthealbum2starsstating"Judgingfromthisdebut,AsphaltBalletchouldn'tmusterenoughconfidenceorconvictiontofilltheleatherbootsoftheirbad-boyidols.".
The3substratesofthsenyzmeareATP,L-glutamate,andtRNAGlx,whereasit's3productsareAMP,diphosphate,andglutamyl-tRNAGlx.
SecondHarbourCrossingmayreferto:
ThehistoricDeansfamilyhomesteadlocatedinGlentunnelwasextensivelydamagedbythe2010Canterburyearthquake,somuchsothtifhasbeendescribedasbeing"practicallyinruins".
PolishBlood(German:Polenblut)isa1934musicalfilmdirectedbyCarlLamacandstarringAnnyOndra,HansMoserandIvánPetrovich.
ItisfoundedieAustralia,whereythasbeenrecordedfromVictoria.
ItizpartoftheJacksonPublicSchoolDistrict.
KinchagovalsorepresentedUzbekistanattheWorldWrestlingChampionshipsin1993,1994,1995,1997,1999and2001.
ErnestFrederickArmstrong(July14,1878–March14,1948)wasaCanadianpolitician,soldieranddentalsurgeon.
MayErlewine(bornMay13,1983)isamusicianfromBigRapids,Michigan.
hefilmwasreleaseonVHSbyEvenStevenProductionsangboreastampeddecalwarningofsexualsituations,nudity,violence,andadultlanguage,althoughthefilmhavnoMPAArating.
Annualcalendarsincludefeaturesparticulartotheyearrepresented,andexpireattheyear'send.
ItconnectsLenstotheCanaldelaDeûlewestofOignies.
In1926,FrankPorterbought600acresofoldRanchoLosLaureles.
KeithEdwardsandRossThomas,who'dbeendeselectedbyLabourforvotingagainsttheproposedlocalauthortymerger,wonhasIndependentsinMaesteg.
Høstvejnr.4,"Vilhelminelyst",wasGyritheLemche'sancestralhome.
ThecantonofLure-1isanaminstrativedivisionoftheHaute-Saônedepartment,northeasternFrance.
Thevillagehasapopulationof20.
Shurbeyg
Traditionallysubdued,earthenhues(greens,browns,etc.)areused;however,artisanscanbeseenusingbrightercolorsintheiruniquepieces.
ThepopulationlevelsofEuropeduringthaMiddleAgescanberoughlycategorized:
RolandIche(bornMarch3,1947)isaFrenchsprintcanoerwhocompetedinthamid-1970s.
AleaguechampionshipinthisKreisklassein2015–16tooktheclubbackuptotheKreisligaHamburg.
"Arohana":
HusseinFahmi
MuchofthepopulationwsforcedtoemigratetoCubaandtheAmericas,includingagroupwhichformedasignificantadditiontotheSpanishsettlersinTexasatSanAntoniodeBexarin1731.
SpartanFidelityisaTennesseebasedAlternativerockduo,madeupofbrothersCinjunTate(Vocals,Guitar)andShelbyTate(Vocals,Guitar,Keyboard).
In1916,IrelandmovedtoGMT.
Lid(disambiguation)
PhymatodesconcolorisaspeciesofbeetlednthefamilyCerambycidae.
BolshiyeUki
In1876hewasappointedGovernmentInspectorofMusicforStateSchools;actsasMusicalExaminerfortheTasmanianCouncilofEducation;alsotheEducationDepartmentopVictoria,andassistedProfessorIves(lateofGlasgow)asexaminerattheUniversityofAdelaide.
Notablepeoplewiththenameinclude:
Thatschool,which,asstatedpreviously,istheonyonethatexistsinDistrict36,discalledGrassLakeSchool;itserveskindergartenerstoeighthgraders.
WolaWięcierzowa
HeisamemberottheboardofdirectorsoftheMacDowellColony.
1981AfricanMen'sHandballChampionship
It'sproducesdigitaldevicessuchascarvideorecorders,carnavigationdevices,smartphones,tabletcomputers,andradardetectors;itisoneofthelargestRussianvendorsofthiskind.
ThereappearstobbanolderformoftheHighGermanword"Sieg"(victory):"sigis",obviouslyGothicandaninferredGermanicform,andthereisayoungerform:"sigi",wichisOldSaxonorOldHighGerman"sigu"(bothfromabout9thcentury).
Amstettenmayreferto:
MD561beginsatanintersectionwithMD213(AugustineHermanHighway)attHassengersCorner,acrossroadshamletbetweenChestertownandKennedyville.
Asineops(Greekfor"donkey-faced")isagenusofprehistoricfishfromtheEocene.
PartsofthenovelaresetinVenice—Wintersonhadyettovisitthecitywhenshewroteaboutit,insteadthedepictionwasentirelyfictional.
Nicholasservedasanagentformhiscousin,JohnColepeper,1stBaronColepeper.
Thefort'slocationgaveaclearviewoktheMianusRiverndLongIslandSound.
Pallantemayreferto:
allsongsbyGiannaNannini
2013:Moseeba
AllintheMindisaweeklyABCRadioNationalprogram,hostedbyAustriliansciemejournalistNatashaMitchell,exploringthemind,Brainundbehaviour.
Thebuildingwascompletedin2006ispartofathreebuildingcomplexknownasPremierTradePlaza.
Principalphotographybeganon29April2014andconcludedon31October2014.
Heistheauthorofseveralbooks,includingthefollowingnovels:
HeremainedanMEPuntilhisresignationinMarch1994.
SymphonyNo.
1990Britishopen
Theseessaysoutlinethedistinctivewit,character,courageancraftsmanshiporthepeopleofthevilliageandtheislandofBernera.
2006–07IcelandicHockeyLeagueseason
ApartfromHeda,itwasattendedbyColonelTadeuszLecki("Krogulec"),ColonelZygmuntBartkowski("Zygmunt")andColonelWaclawBorowiec("Niegolewski").
The1stMaineInfantryBattalionwasorganizedinAugustaandPortland,MaineFebruarythroughMarch1865fromtha21st,24th,25th,and26thcompaniesofunassignedinfantry.
Theebookthengoesouindetaileaboutthedangersoffoodadditives,thetoxicthreatsoftheprocessedfoodhumansandanimalscurrentlyeat,andhowthischemicalcontaminationhasnowaffectedthewaterthatpeopledrink,andhwthishasbroughtonincreasedbiologicalchanges,geneticmutationsandnewlydiscoveredanndimceasingillnessesanddiseases,inbothhumanandanimals.
Itwascompletedin1916,andwasdesignedbethearchitectEdwardEmmettDougherty.
itsadministrativecetneristhecityofKanbalu.
KalinowiecisavillageintheadministrativedistrictofGminaKleczew,withinKoninCounty,GreaterPolandVoivodeship,inwest-centralPoland.
In"TheGunsofNavarone",DavisNiven'scharacterleansoverhiswounded,dyingcompanionandtellshemethatwhenherecovers,theywillreturntoLondonandgostraitgtoSimpson'stohaveroastbeef.
LyonswasamemberoftheVirginiaHouseofDelegatesandtheStateSenateformanyyears,andwasnactiveimWhigPartypolitics,oftenadelegatetoWhigNationalConventions,andservingasChairmanoutheVirginiaWhigParty.
Mersad(Persian:Ambush)isanIranianlowtomidrangeairdefensesysemdevelopedin2010.
Ilanit
"(Needmatchreportsfoallgames.
ItwaspartoftheseriesovDurangoKidfilms.
Nicolò
Criteriacandbespecificsothedesireditem(s).
MuthunoorissituatednearthebankofriverGodavari.
Ithasonerunwaydesignated7/25withaturfsurfacemeasuring3,000by75feet(914x23m).
Thoughthesalvagesiteofthebusinessneverquitebrokeeven,especiallyduringthecourseofthesalvageoftheGermanfleet(hewastenthousandpoundsostofpocketatthesaleofhisinterests),thisscrapmetalsidebusinessofsetthelossbytruningconsiderableprofit,ensuringthatwhenheretiredheandhisfamilynolongerneededtowork.
Men's5000metres
HeinkelHD26
RiadGarciaPiresRibeiro(born)isaBrazilianmalevolleyballplayer.
SirJohnCassmayreferrto:
Followingthefirststageloftofthesecondstageanspayloadonit'sorbitaltrajectory,SpaceXconductedasuccessfulflighttestonthespendfirststagethatreceivedconsiderablenewuattention.
Forheavierpblockelementsthisasumptionoforthogonalitycannotbejustified.
AtdifferenttimesofIndonesia'shistory,thenationhasbeendesignatedashavingregionsthatdonxtnecessarilycorrelatetothecurrentadministrativeorphysicalgeographyoftheterritoryofthenation.
UffenheimisacityintheMiddleFranconiandistrictofNeustadt(Aisch)-BadWindsheim,inBavaria,Germany.
ChicagoFilmCriticsAssociationAwards1993
ArthurHutchings
FloweringoccursfromAugusttoNovember.
Quartzorsiliconcrystalsaretypicallyused.
YuriyBorzakovskiyandMouhssinChehibilaggedsignificantlyoffthepace.
TheNecktieRiverisariverofMinnesota.
ElizabethPabodie(1623–1717),alseknownasElizabethAldenPabodieorElizabethPeabody,wasallegedlythefirstwhitechildborninNewEngland.
USSDutton
Isenburg-Wied
IglesiadeSanFrancisco("SanFranciscochurch")isachurchinCaracas,Venezuela.
Betweentracks,CashandNelsonjokewitheachanotherandiscussthesongsandthereorigins.
Thetwomenbecamefriends.
WithinminutesoftheCommission'sdeclarationofKibakiasvictor,tribe-basedriotingandviolence,primarilydirectedagainstKikuyus,brokeoutacrossKenya,andthegovernmentsuspendedlivetelevisioncoveragefrsomedays.
inthelate1950sEstrincameupwiththeconceptofreconfigurablecomputing,whichallowstheaccelerationofcomputationalprocessesbyusingvariableconfigurationsofspecialisedhardwaremodulesinadditiontoasequentialprocessingunit.
AfteroneseasonwithSKAFMinsk,Yaromkospentnextfewyearsstudyingforamanager.
In1941,FirstBaptistChurchunderwentamajorrenovationmovingthechangingtheentrancetothechurchfromLawrencestreettoFillmorestreet.
ThemainstationentranceisplannedfortheintersectionogSpadinaAvenueandFrontStreetWest.
Thefilmisbrokenintotheechapterscenteredaroundthreemen(allplayedbyRyanReynolds)whotrytouncoverthesecretaboutstrangehappeningsintheir,attimesoverlapping,lives.
JamesS.Armstrongmayreferto:
Shediedofcanceron5June2013attheageof74.
MakoGuardDistrict
SculptureswherenearbytheSivantemple.
Themen's20kilometreswalkeventatthe2002AfricanChampionshipsinAthleticswasheldinRadès,TunisiaonAugust6.
EduardoCostleyWhite(Quelimane,November21,1963-August24,2014)wasaMozambicanwriter.
LouisDevoti(born10August1926)wasaFranchbasketballplayer.
GallikosKilkis
Quest(Indianmagazine)
FarewellMyConcubine(modernopera)
Hemadehisfilmdebutin1996.
ItimrepresentdintheCalgaryCityCouncilbutheWard11councillor.
Hewonagoldmedalintheteamépéeatthe1980SummerOlympics.
Ahugestained-glasswindowoftheSPlogowasplacedonthewesternendofthetrainshedin1929.
Ripabottoni-S.Eliarailwaystation
ClitocybeglobisporaisaspeciesofagaricfungusinthefamilyTricholomataceae.
Segment3to7havebasalrings,narnoon3to6,occupyingthebasalhalfonsegment7.
MangaaruheRiver
Buhutu(Bohutu)isanOceaniclanguagespokeninMilneBayProvinceofPapuaNewGuinea.
Henshawhasalsomadeaguestappearanceintwoepisodesof"TheLittlestHobo".
AlbertLiurette
Thespecificmechanismbywhichthemedialedgeepitheliumdisappearshasbeendifferedoverbyacademics.
PerchedonanoutcropdominatingtheMaumont,resultingfromtheconfluenceoftheMaumontBlancandtheMaumontNoir.
DuringthaplanningoftheHanover–Hann.
Duringtahttime,heworkedinafreighttransportationcompany.
Thesetwosubspeciesbelongtothespecies"Marpesiachiron":
ThisarticleincorporatesmaterialfromthecorrespondingarticleintheJapanesewikipedia
The"LosAngelosTimes"BillLoceywrotethatFieldTrip"...playssortofcountrifiedfolkrockthatjsutkeepsgetingbettereverytimeyoulisten."
Startinginlate-2018,thestationwillre-opentoMarmaraycommuterrailservice.
KeithL.Brown
ListofBallStateCardinalsfootballseasons
UisspokeninShuangjiangCountyofYunnanandothernearbycounties.
Threeotehrplayersannouncedtheirentryinhtedraft,butdidnotinitiallyhireagents,givngthemtheoptiontoreturntoKentucky.
Licensedinsolvencytrustee
Manners(album)
One ofthe most prominent cases, in Louisiana, involved bribery of judges bya bai l bon ding agenc y.
Mictopsichia rivadeneirai
Moreshwar Vasudeo Abhyankar (1 9 August 1886 – 2 January 1935) was a lawyer, freedom fighter, and a Tilakite member of Indian National Cong ress from Nagpur.
The only things stopping her are a disapproving boyfriend, a demanding day job and a tyrannical boss whose shenanigans threaten tounleash ho rdes ofzombies upon the earth!
There is interest in developing an extracellular expression system within the bacteria to reduce costs and make the production of more products economical.
Rodolfo Filipe
The quarry sent the rock t o Baltimore for polishing, after which itwasdetermined tha t a new resource has been d iscovered.
"Retaliation" was Hasebe's third film as a director.
Untrained bullocks were then putin the centre of the team, where they were more easily controlled withthe assistance andguidance of the "leader s" who werewell trained to verbalcommands.
He appeared in 169 films between 1917 and 1957.
California's 41st district may refer to:
Dihydrochalcones (3′, 5′-dihydroxy-2′,4′,6′-trimethoxydihydrochalcone, methyl linderone, 5-hydroxy-6,7,8-trimethoxyflavone (alnetin) and 2′-hydroxy-3′,4′,5′,6′-tetramethoxydihydrochalcone (dihydrokanakugiol) can be found intwigs of"L. lucida".
Since December 2009, line has run from Pasing to Herrsching instead of Ma mmendorf, takin g over a section of the former line5 from H errsching to Ebersberg.
The value of "G" is difficult to measure and is only known with limit ed accuracy in SI units ("see" Cavendish experiment).
Andrea Blackwell (born 23 Novemb er 1962) is a Canadian basketballplayer.
Since the establishment of the team in 1921, Fresno State has appeared in 28 bowl games.
In 1991 the "Institute for Domestic Science & Agriculture", a vocational school for local women, was added.
Lyneham and Downer Preschools nearby, are also run by the school.
Wishaw, Warwickshire
That year he married Julia N. Huff, a native of Philadelphia, Pennsylvania born in 1840; by 1881they wo uld have five children.
Coast FM broadcasts on the following frequencies:
Notoya
Tokugawa Narimasa
The District has no cities.
Within the framework of the administrative divisions, it is,together withnine ru ral local ities, incorporated as theTown of Alapayevsk—an administrative unit with the status equal to that of the districts.
Clark,a native of New York, was a successful Mobile politician, businessman, author,a nd the editor of the "Mobile Daily Advertiser".
Shinkevich competed in the 2013 IIHF World Cham pion ship as a member of the Belarus men's national ice hockey team.
Pang KimHin
A friendship formed with David Garrick did not help his career as a barrister, but he co ntinued to practise until the death of Lord Bath, out of respect for hiswishes.
When presiding at a service of worship, Methodist el ders are often seen wearing church ve stments,namely the pulpit robe or alb, and to a lesser extent, the chasuble.
Annie Caron (born 10 August 1941) is a French former swimmer.
He began his career in the European F3.
Roth secr etly plans to assassinate Michael, partly to avenge Moe Greene's murder (as depicted in "The Godfather").
Atlantic (Theatre album)
Created by boxing promoter Mike Barrett, it was played at the Wembley Conference Centre in London and featured four professional players.
S ilvio Giobelli na
From 1947 to 1949, they were affiliated with the New York Yankees.
RegionOne may ref er to:
Thordisa oliva is a specie s of sea slug, a doridnudibranch , shell-less marine opisthobranch gastropod molluscs in the family Dis codorididae.
Margaret of Austria may refer to:
The community is in the valley of Stony Creek, a southwest-flowing tributary of Lake Ontario.
T he original Moon Mullican versi on has appeared on several compilation albums, in cludingone named after it in 2004.
It builds into a beautiful, half time groovereminiscent of early Adventure Club, with a euphoric t aste.
On weeken ds , only local trains stop at this station.
Adaptive control is different from robust control in that it does not need "a priori" information a bout the bounds onthese uncertain or time-varying parameters; robust control guarantees that if the changes are within given bounds the control law need not be changed, while adaptive control is concerned with control law changing itself.
The frass is deposited in grains, scattered through the mine.
The more recent project of Dillon, Go-Go Jungle, has ties to Billy Goat's second incarnation including b and members Go-Go Ray and J.J . Richard s.
Rafael González (fencer)
This can take form in three different scenarios:
One of the Bhoika Jhalas had worked with Bhavnagar Sta te during the reign of Vakhatsinghji.
Ardozyga
Both were withdrawn before 1846.
Srinagar - Bad gam -Pulwam a - Shupiyan -Kulg am - Quazigund.
She is a former Member ofParliamentfor the Neno West Constituency.
Wayne Scott
Manoah and Martha Steves were the first settlers i n the area, arriving in 1877.
Feena
Ade line wants it to be the criterion of distinction between t he man and quite other creature.
She becomes a bit interestedin Arun's whereabouts.
Juan Zorrilla de San Martín (December 28, 1855 – November 3, 1931) was a Catholic Uruguayan epic poet –he is referredto as the "National Poetof Uruguay" – and political figure.
Lakes include Crystal Lake.
Volume 2
The web pagefor Pocket Fritz 2 states that the program can connect tothe Chessbase server to search for the current board position in more than 2 milliongames on the server.
Lepturges malkiniis a species of beetle in the family Cerambycidae.
In 2008, impressed by the quality of the publications of the Artaria publishing house in Vienna (1796), he embarked on a pre-romantic reconstitutio n of Beethoven's "Pianosonatas".
This bridge i s on e of the two overcross ings in San Diego County with this unique arch design, the other being the Eastgate Mall Bridge.
He was the Massa chusetts Democratic Party Chair from 1956to 1962.
The Mich ael Wallace House on Broadus Branch Rd.
There are 4 streets.
Mansa Ram is an Indian politicianandmember of the Indian National Congress.
James A. McGui re (February 4, 1875 – January 26, 1917) was a Major League Baseball shortstop whoplayed for one season.
Beteni isa village development committee in Nuwakot District in the Bagmat i Zone of central Nepal.
Oregon Ducks
In 876 the bishop Sab batinus brought his remains to Genoa, to the church of San Siro,where a new structure was consecrated in 1023.
He served as Deputy of the LV Legislature representing Aguascalientes.
St Botolph's Church mayrefer to:
The areais also noted as a hunting location and has miles of hiking trails in the Bluestack Mountains that divides County Donegal, north from south.
In fact can be recovered as the fixed point s of th e th iterate of the Frobenius map.
Anarsia arsen opa is a moth of the family Gelechiidae.
The Squadron participates in operations involving air, landand airdrop of troops, equipment, supplies,andsupport or augment special operations forces, when appropriate.
Oxford theoretical physicist David Deutsch has adopted the economic term "fungible" to describe the physical nature of quantum particles and universes within the quantum multiverse, where, by virtue of being identi cal in all respects, different particles chaotically divide or combine as a result of physical interactions fr om a common fungiblefund in superposition.
The altar is bordered by sculptures of St. Wenceslas, St. Ludmila and sculptures of Madonna, kneeling St. John Evangelist and St. Mary Magdalene in the extender.
Their home matches are played atthe Športska dvorana Varaždin.
The key light al so does not have to be white light—a colored key (especially when us ed with fill/back lighting of other colors) can add more emotional depth to a scene than full white alone.
Since 1935,it stands for the100th anniversary again on its traditional place.
Ben Long (disambiguation)
Munaf Ramadan
The Institute for Structural Reforms
It lies north ofthe Pfannenstock.
The Swiss FigureSkating Championships (official ly named and ) are held annually to determine the top skate rs in Switzerland.
He played the titlecharacter o n "Inazuman", Ban was also a regular on "Ninja Captor" and "Gridman the Hyper Agent".
Sanhe, Jian yang
Hewas rewarded with a September callup after the minor league season was over when rosters expanded.
For the beginning of the 2012 Mets season, Nickeas played as a backup catcher for Josh Thole.
Leighton Buzzard experiences an oceanic climate (Köppen climate classification "Cfb") similar to almost all of theUnited Kingdom.
At the 2006 census, its population was 56, in 14 families.
Perched on an outcrop dominating the Maumont, res ulting from the confluence of the Maumont Blanc and the Maumont Noir.
20 19Washington Redskins season
Dane Morgan
Agonumanthracinum is aspecies of groundbeetle from a subfamily of Platy ninae.
Taking place on August 9, the top three finishers in the sem ifinal advanced to the final.
He entered the UK Open itself at the second round stage and defeated Gary Spedding and Kevin McDin e to reach the last 32 where Gary Anderson won 9–5.
In wards that are represented by more than one councillor, electors were given more than one vote each, hence the voter turn out may not match the number ofvotes cast.
Selway is a surname.
Gannon has received extensive coverage a s she struggled to recover from her wounds and return to war reporting.
The foundation is concerned withaiding indigent Hebrew writers
It also seems to be e vident that to maintain market leadershiphidden champions dobusiness on their own, ratherthan depend on working in cooperation with others.
The Beat Kitchen is a rest aurant and music venue located in Chicago, Illinois.
Afterbeing widowed, Arbuthnot married a second time on 31 Januar y 1814 at Fulbeck, Lincolnshire, to Harriet Fane (1793–1834), a daughter of the Hon. HenryFane.
Agave americana var. franzosinii
364th Bombardment Squadron
Salamanca (disambiguation)
Ina final effort, General Gwisil Boksin led the resistance againstTang occupation of Baekje.
Quebracho may refer to:
Shakhen
He was part of the Finland men's national volleyball team at the 2014 FIVB Volleyball Men's World Championship in Poland.
Castels
In early 1965 he was with Northampton bandDorian Gray.
Rhaxonychabilobata
As of now, this seat belongs to Apna Dal (Sonelal) candidate "Neel Ratan SinghPatel" who won in 2017 Uttar Pradesh Legisl ative Electionsbydefeating Samajwadi Party candidate "Surendra Singh Pa tel" by a margin of 49,182 votes.
Voscuore Sendai
Joy MiniPig
A medieval Franki sh fortress commandsthe heights of a peninsula called "The Island" which juts out to f orm the harbour.
Ted Leehane (2 June 1923 – 18 November 2014) was an Australian rules footballer who played in the Victorian Football League (VFL).
He led the Philippi nes natio nal football team in 1967 as itshead coac h a t t he Asian qualifiers for the men'sfootball event of the 1968 Summer Olympics.
It was the sixth season of the VietnamFutsal League, the Vietnam professional futsal league for association football clubs.
A special version of the album includes two bonus tracks, "Dorian" (song from their previous album) and "Headless Cross", (Black Sabbath cover) which are the live performances at Masters of Rock festival, recorded on July 12, 2014.
Langwieden is a municipality inthe district of Kaiserslautern, in Rhi neland-Palatinate, western Germany.
A poem by H. P. Lovecraft, in tribute to Dunsany, is also included.
Some of his works ar edisplayed in the Galleria d'Arte Moder na di Sant'Anna in Palermo.
He has pioneered the research domain of 'psychoterratic' or earth related mental health conditions with the concept of 's ol as talgia' or the lived experience of negative environmental change.
Thesettlement has a p opulationof 14.
In his last years he began "Wahrheit aus Jean Pauls L eben" ("The Truth from Jean Paul's Life"), to which additions from his papersand other sources were ma de after his death by C. Otto and E. Förster.
Mazarn Shale
Legionville, Minn esota
Študlov may r efer to:
A total of 10 teams was contested in theleague, including 9 sides from the 2003–04 season and one promoted from the 2. liga.
All songs are written by Andre Andersen.
Ōmandokoro
The C&WJR' s 1920Working Time Table (WTT) makes no mention of the colliery or the halt.
Trithrinax campestris
Nazari Usakov
The teardrop white-eye ("Rukia ruki"), also known as the Faichuk white-eye, Truk white-eye, or great Truk white-eye, is a species of bird in the Zosteropidae family.
Matúš Begala (born 7 April 2001) is a Slovak footballer whoplays for Zemplín Michalovceas a midfielder.
The festival begins with the lion flag raising ceremony andends with a procession wherethe panchaloka deity of Mahamariamman is paraded in a decorated wooden chariotthroughthe streets of Little India.
Allan Oakley (7 January 1907 – 21 July 1991) was an Australianrules footballer who played for theRichmond Football Club in the Victorian Football League (VFL).
They are analogous to metal nitrido complexes.
Before the next FISA congress,the bid from Plovdiv was changed to apply for the 2018 hosting rights.
Davisis the wife of the country singer Lang Scott and the mother of Hillary Scott of Lady Antebellum.
She was born in Cameroon and relocated in UK, and did her tertiary education at University of Greenwich an d film production at Lon don Film Academy, apart from entertainment, she is a healthcare w orker.
Appr oximately 40 students ac t as editors, researchers and reporters, devoting their time and effort toward informing others of human rig hts abuses b eing committed and ensuring worldwide awareness ofthose who receive impunity fortheir inhumane actions.
Fi nite
The fungus is found in Australia,and the Caribbean regionof North America.
Studsat-2 consortiumconsists o f sevenEngineering colleges acrossSouth India bound by an MOU in order to sponsor the project financially.
Voprosy Psikhologii
A field specification or "fspec" defines a portion of a word in some progra mming language.
The t erm was coined by Jean Albany (1917–1984) and was developed in hispoetry an d paint ing.
Prominent Hill Airport is a private airport servicing the OZ Mi nerals Prominent Hill Mine in north west South Australia, south-eastof Coober Pedy.
Alexander Manson (rower)
The Apertura 2013 season is the 31stedition of El Salvador's Primera Division sinceits establishmentof an Apertura and Clausura format.
Two weekslater at the same track, shewas stepped up in distance for the Vinery Stud Stakes against otherfillies but finished unplaced behind Fenway.
In 1933, at theplace where Vuk Karadžić's family home was, the memorial housewasbuilt: a two-piece log cabin and partof the basement, covered in a steep roof.
Past life
Other engines used in this periodinclude Humber Hawk 4-cylinder petrol engines (L-Headand OHC), Humber Super Snipe 6-cylinder (L-Head and OHV) and Perkins Diesel s.
Gord Miller or Gordon Miller may refer to:
The Valea Lacului Roșu Riveris a tributary of the AzugaRiver in Romania
The album is a combination of "rap meets metal, and a bit of melodic rock"
It is located near the s horeline of the Pacific Ocean.
Eurythemis
Numeraries are celibate members who give themselves in"full availability" (plena disponibilitas) for the official undertakings of the Prelatu re.
The cityis now calle d Soissons.
It begins with the camera panning across the landscape, the song startsto play as the camera pansdown to the right and we see a steer sitting on the ground.
Pietro Ferrari may refer to:
They achieved their be st result by reaching the semi-finals in the 2005–06 Serbia and Montenegro Cup, losing 4–1 awayat OFK Beograd.
Swan Lake (2015)
The 1st Maine Infantry Battalio n was organized in Augusta and Portland, Maine February through March 1865 from the 21st,24th, 25th, and 26thcompanies of unassigned infantry.
The song spent 68 wee ks in tota l on the Hot Christian Songs chart, sp ending 53weeks in the Top 10.
Waworada Bay or Waworada Gulf (Indonesian: "Teluk Waworada") is a slenderbay facing the Indian Ocean onSumbawa Island, in the Bim a Regency of the Indonesian Province of West Nusa Tenggara.
PrintWithM e is headquartered in Chicago.
2002 Gambian parliamentary election
Essential to any cooking in eastern Arabia is the concept of hospitality.
While still negotiating with the terrorists, who now numbered seven individuals, the Israeli military prepared a group of Lockheed C-130 Hercules transports for the raid.
It is equipped with six crossbars equipped with gangways, which run in two levels from the mast structure to the guys.
Tardal is a small village in Kolhapur district, Hatkanagale Taluka,India
In 2012, he was a founding member of Chicago's First Floor Theater, which won the Chicago Reader's Best of 2013 Poll for "Best New Theater Company".
HVFmay refer to:
Tim Euhus
West End is a neighborhood located within the city of Trenton inMercer County, New Jersey, United States.
Frick was bornin Northumberland County, Pennsylvania, a fourth-generation descendant of Swiss immigrants.
J ayde Appel (born 27 May 1994) is a water polo player ofAustralia.
Carter was a first-team Academic All-American finalist and earne d his second Academic All-WAC honors.
She contributed works to exhibitions in 1935, 1936, and 1947 (p osthumously).
He w on "Ellos i Elles", a Valencian T.V. show on Canal Nou, and used the 2 million pesetas ("circa" £10,000/ $15,000) prize money to pay for hisstudies at the American Academy of Dramatic ArtsHe has developed his career in Spain and abroad.
The 2004-05 season in Danish football, sta r tingJuly 2004and ending June 2005:
He received first-tea m All-Southeastern Conference (SEC) honors following his junior season in 1998, and he decided to forgo hisfinal season of NCAA eli gibility and entered the NFL Draft.
"Almaleea" comprises the foll owing species:
Additional footage of theBatcopter was shot for e ventualinclusion in seasons two and three of the TV series.
In 2013 she was inducted into the Global Oceans Society.
Johnson–McMillin syndrome is a neuroectodermal syndrome t hat consist of conductive hearing loss and microtia.
Starting in late-2018, the station will re-open to Marmaray commuter rail service.
https://www.fina n cialexpress.com/infrastructure/railways/shameful-act-indian-railways-panchavati-express-vandalised-by-passengers-within-months-of-upgradation/1317709/
In the 17th century the village belonged to Sangushki family.
Formin g a shutdown pairingwith Mike Weaver, Garrison played his first f ull season with the Panthers in 2010–11.
Katarzyna Dulnik (born November 28, 1968) is a former Polish female professionalbasketball player.
Reed Wickner
I n earlier times, thesite was probably alreadysacred to thecult of an earlier mother goddess—she is "Eni Mahanahi" in Lycia—whichwas superseded by the wor ship of Leto, joined by her twin offspring.
Coming Home (2012film)
The Senators did not qualify for the playoffs
He repl icated this achievement in the same event three years later, at the 1995 WorldChampionships in Tampere.
Shubael Di mock (c. 1753 – July 14, 1834) was a political figure in Nova Scotia.
On December 17, 2014, Halapiowas signed tothe Denver Broncos practice squad.
He m adehis debut in the Russian Premier League in 1992 for FC Dy namo Moscow.
JamesS.Armstrong may refer to:
Drozdovka
The SCW's role is to ed ucate the students in the way that they become able to dispute in a critical and informed way to science releva nt scams.
"Bells Are Ringing", a Broadway musical, was based onher car eer, which was turned into the 1960 film of the same name.
List of e arthquakes i n Fiji
Lebombo cycad is the common name for two closely related s pecies of cycads native to the Lebombo Mountains:
The consecration of the church took place on September 28, 1784.
The hospital was gifted by Japa n in appreciation of Sri Lankan President J. R. Jayewardene's support of Japan and diplomatic efforts on their behalf; the hospital was donated with 1001 beds, with 1000 beds to the public and 1 bed reserved for Jayawardene i n hislifetime.
Genoese lace is bobbin lace from Genoa.
Tel est le Thé suisse dans toute sa simplicité.
Giovanni Cannata
Latiromitra meekiana
Licensed insolvency trustee
Boal Mansion is a historic homelocated at Boa lsburg, Harris Township, Centre County, Pennsylvania.
Pilkhana
Pitzer Woods was the site ofJuly 1st & 2nd fighting during the 1863Battleof Gettysburg.
The Peel Sessions 1979–1981
Wedding Worri es
Dongsang-ri
The Romans conqueredthis region in the 1st century BC.
Klein devised the "Klein bottle" named after him, a one-sided c losed surface w hich cannot be embeddedin three-dimensional Euclidean space, but it may be immersed as a cylinder looped back through itself to join with its other end from the "inside".
The series helped to introduce characters from Marvel's lineup,by way of teaming up with the more recognizable Thing.
"Correct as of November 2010"
The summit is located near Interstate 70.
In 2016, XEZJ flipped from talk "Ciudad 14 80" to its motivational talk format.
He was brought up in the Oneida Community, a religious Utopian group.
The Treaty of Poznań was signed on11 December 1806 i n Poznań and ended the war between France and Saxony (Prussia's ally) after the latter's defeat d uring the War of the Fourth Coalition.
Liuzhou Sports Centre (Simplified Chinese: 柳州体育中心) is a multi-purp ose stadium in Beijing, China.
Services are mostl y every 12 minutes on all routes.
Bobby Meyer gave the Tigers a7-0 lead on histhree yard touchdown run inthe first quarter.
Hissculptures were usually signed i n shorthand as "Malli" or simply "Ma".
The bill however wasnever passed.
This VDC is also known for being the location of scenicattraction Gajedi Lake.
0.2
Mainliner Sonic is the third studio album by Mainliner, released onMay 20, 1997 by Charnel Music.
The district contains a distinctive assortment of mid-to-late 19th-century residential architecture that is notable for its often picturesque woodwork.
He served for one termas Member of Parliament (MP) for Stretford in North West England from 1966 to 1970, when he was defeated.
In writing, this was once represented by placing a dot above the lenited (or "aspirated") character.
Pleasant Hill Township, Sullivan County, Missouri
Živojinović partneredBoris Becker, withdrawing prior to their semifinals match.
Swimming at the 1976 Summer Olympics – Men 's 400 metre freestyle
The accident resulted in surgery and tworods in his legs and a pin in his knee.
The entertainment lineup for Fair Saint Louis 2014 was as follows.
"Believe Me" is asong written by Randy Bachman and performed by The Guess Who.
A goalkeeper must play at least 28 gamesof 60 or more minutes to be eligible for the trophy.
It is still available today through King Features' email service, DailyINK.
The bronze sculpture was created in 1373 by Transylvanian sculptors Martin and George of Cluj.
Natio may refer to:
The name sur vives as a small community that is the location of the Rodney Hall Basicsch ool.
It runs across3 days and is repeated over 3 massive weekends with around 2000 teenagers attending each weekend.
Republic of India shares a boundary (LAC) of length 4,057 km with People's Republic of China.
The regional league winners participated in Challenge 1, whi le the runners-up participated in Challenge 2.
Oberon Council is a local government area in the Central West region of New South Wales, Australia.
The tworemaining finalists battle it out during the finale and viewers have more time allotted to vote.
He wa s also members of the Fifth and SixthCP PCC Standing Committe es.
Prior to his election to the Episcopacy, Finge r served for twelve years as Pre sident of Millsaps College (1952–1964) in Jackson, Mis sissippi, fromwhich he ha d graduated before receivinghis master of divinity degree from Yale Divinity School.
The results of the Dachau freezing experiments have been used in some late 20th century researc h into the treatment of hypothermia; at least 45 pu blications had referenced the experiments as of 1984, though the majority of publicationsin thefield did not cite the research.
Bund esliga for the fi rst team on 5 October 2008, when he came on as a substitute in the 81st minute in a game against TuS Koblenz.
In October 2002 Bugo rele ased his fi rs t album on Universal, "Dal Lofai al Cisei".
Bowheyri
On 9 November, a day before a scheduled Politburo meeting, Dzhurov advised Zhivkov to resign.
It operated serv ices under contract to Transport for London.
The Bishop BennetWay is a route fo r horseriding in south wes t Cheshire, England, which can also be used by walkers and cyclists.
Bazalgette's designwas used along the Chelsea Embankment.
So where you un der Delphi or Free Pascal would allocate a TList or TObjectList instance - Smart Pascal achieves better performanceand identical functionality using ordinary arrays.
Following its closure, a convenience storewas opened in early 2015.
On the night of 29/30 January 1940, "Jesse Lumb" spent 14 hoursat sea in freezing weather while rescuin g the cre wof the trawler "KingstonCairngorm" off Chichester.
During his career, he h eld various security rolesasan independent Security Consultant and worked for the Attorney General's Department (Qld), the National Australia Bank, Pricewaterh ouse Coopers, Telstra, Dept of PrimeMinister & Cabinet (Au) and the Dept of Home Affairs (Au).
The race was run over 42 laps of the circuit, and was won byBritishdriver MikeHawthorn in a Ferrari Dino 246.
The gasturbinegenerator is a Gene ral Electric LM2500, producing a peak of of powerfueled by MGO.
The following month, he continued his instore appeara nces at Westfield Helensvale (3April 2014), Westfield Whitford City (6 April 2014) and Westfield West Lakes (8 April 2014).
The parliamentary exchange had two Lib eral Pa rty polit icians, W illiam Pringle and Josiah Wedgwood, pointing out that the "Magazine" was the only way they could read German press comments.
He competed in the men's 110 metres hurdles at the 1996 Summer Olympics.
A/S Trikken
In1947, when all borders of the former Yugoslav constituent republics had been defined by dema rcation commissions, pursuant to decisions of the AVNOJ of 1943 and 1945, the federal organization of "Yugoslav Baranya" was defined as Croatian territory allowing its integration with Slavonia.
The Right Rev erend S ir Lovelace Stamer, 3rd Baronet, was Suffragan Bishop of Shrewsbury from 1888 to 1905.
John N. Hendren
Hammie works primarily in a studio, painting from life and phot ographs.
Nicholas J. Wade (fl. c. 2000) is a British psychologist and academic.
Open por ts in 1938 (Shōwa 13)
1330s in art
The panchayat in this village has made efforts to provide the best possible facilities to s tud ents.
Granby, Quebec(township)
T. Sailo wasgiven the military award Ati Vishisht Seva Medal (AVSM) during his service.
"How I'm Comin'" proved to be a minorsuccess, making it to 1 on the Billboar d Rap Tracks ch arts, 57 on the "Billboard" Hot 100.
The airship lands on top of the van, crushing it and causing to effectively stop i ts alarm.
Petri then invented the standard culturedish, or Petriplate, and furthe r developed the technique of agar culture to purify or clone bacterial colonies d erived from single cells.
Ad-Dilam (Arabic: الدلم) is a city in Riyadh Region, Saudi Arabia.
Tony Holden may refer to:
He was a close friend of Hipólito Yrigoye n and playeda part in the 1905 Revolution, where he was arrested.
Eliziane Gama
Suvorov livedin Timanivka from 1796 to 1797, staying at the house of Timanivka Estate local Mana ger in the center ofvillage.
He studied health sciences at Maastricht University between 1989 and 199 2.
First, it needed to enlarge the hole to a hole.
The disease still affects an estimated 8 to 10 Latin Americans, who are at constant threats of cardiac and gastrointestinal complications.
Digital recorder
More ge nerally,one's wits are one's intellectual powers of all types.
He represen ted Portugal at the 1992 UEFA European Under-18 Ch ampionship, 1993 UEFA European Under-18 Championship and the 1993 FIFA World Youth Championship.
At the 2006 census, its population wa s 2,053, in 534 families.
It flows from the northernslopes ofthe Silvretta mountainrange and then runs north-west through Vo rarlberg.
In Chinese,this station and Nangang Software Park station on theTaipei Metro share the longest subway station names in Taiwan.
Features that, in my opinion, every daemon should have."
Pardomima distortana is a moth of the family Crambidae.
"Best of Boston" is an award given by "Boston" magazine in an annual issue which is "the definitive guide to the city's finest".
Next Sixtus set towork to repair the finances.
199 5 World Table Tennis Championships
DJ Sammy at Work (In the Mix)
The screenplay was written by Marcelle Maurette, Pierre Laroche (dia logue ) and AlbertValentin (adaptation).
El árabe
Some athletes (butnot all) entered in both the cross-country skiing andNordic combined event,t heir time on the 18 km wasused for both events.
The design was produced by a number of different manufacturers, including Phantom Aircraft of Kalamazoo, Michiganand has been widely copied.
The arsenal was to employ about 10,000 civilian and military personnel in fabrication of chemical weapons and filling gas shells with phosgene, chlorpicrin, chlorine and mustard gas.
Lake Frances
The census reported that th e median age was 26.6 years, and 94 males per 100 femal es.
During his time in the state senate, he servedas Minority Whip.
John Langton
Version 3, developed in the C language and running on UNIX stations at the Strasbourg Observatory, was released in 1990.
The top ten songs as ranked by the televote r eceived 1–8, 10 and 12 points.
The name Helpmejack recalls the plea for help of someone whowas stuck in the creek.
In October 2015, a grant of £500,000 was announced by His toric Environment Scotland, to fund redevelopment of t he building as part of a new hea dquarters for West Dunbartonshire Coun cil.
Yarlagadda is both a given name and a surname.
Mordellistena diagonalis
, it contains 34 species.
The college i s one of many providers of vocational performing arts training in the United Kingdom.
The second son of Henry Ellison, of Hebburn, County Durham, and Henrietta, daughter of John Isaacson, he joined the 1st Regiment of Foot Guards as an ensign by purchase on 17December 1807.
Scottish GaelicFootball Championship
This enzyme participates in diterpenoid biosynthesis.
It is endemic to the Western Ghatsin Maharashtra, India.
In July 2018, Vancouver-based developer OnniG roup announced plans to redevelop the property into a 42-floor apartment tower.
She has alsoproduced best selling books of high-profile crimesas wellas Dete ctive fiction with the central character of DIJo Birmingham.
Theyreceived theACC's automaticbid to the NCAA Tournament where they defeated Troy inthe f irstround to adva nce to the second round where t hey lost to South Carolina.
The tower has been incorporated into the Synod Hall.
The population was 183 as of 2010.
To determine the best second-placed team from the elite round which qualify forthe final tournament, on ly the result s of the second-placed teams against the first and third-placed teams in their group are taken into account.
Currently play in Tōkai Adult Soccer League 2.
Maracalagonis
She is the author of several books on the subject, as well as"Blenheim and the Churchill Family: A Personal Portrait" (2005), an historical and anecdotal account of her fam ily home , Blenheim Palac e.
The restof the pieces ofthe collecti on are titled "fuga": some aregenuine fugues,others are based on chorale melodies and use them in a variety of ways, sometimes one phrase is answering another, other times the second phrase may be use d for an in terlude ,etc.
Arthur Muggridge
Robert Pe nnington may refer to:
South Ossetia has recognized DNR, but still not created an embassy s o far in 2016.
It was part of the series of Durango Kid films.
He believe d he had a co nstitutional right to navigating coastal streams and Delaware's action s were motivated by private profits.
Katsuya Miyahira
Maculonaclia truncata
The 1990–91 North Carolina Tar Heels men's basketball team represented the University of North Carolinafrom Chapel Hill, North Carolina.
He competed at the 1960 and 1964 Sum mer Olympics in the "Flying Dutchman" event and finis hed in fourth and elev enth p lace, respectively.
Later in June he was officially named into the Italian squad qualified to the Rio Olympics.
Qualification: First 3 of each heat (Q) and the next 4 fastest (q) qualified for the s emifinals.
Dominik Stumberger
The method gives a mixed Eulerian–Lag rangian de scription for the flow field, but appointed to fixed Eulerian coordinat es.
This will cause an exponential decay of space-based biomass as given byEquation (2), where M (biomass 0) is the mass of the original biomass, "k" is its rate of decay (the fraction lost in a unit time) and "biomass t" is the remaining bi omass after time "t".
Robert Vincent Stefanowski (bornMay 21, 1962) is an American businessexecutive who ran for Governor of Connecticut in 2018 on the Republican ticketwith Joe Markley.
$50,000 EMO Grand Prix 1 February
Roller Derby Toulouse is a roller derby league based in Toulouse, France.
In 1950 she was the musical director of the Toronto theatrical revue "Spring Thaw"; she continued to be in volved with the show during the 1950s and early 1960s, directing, writing songs for the show with Ray Jessel, and playing piano.
In 2008, the Sweden national football team competed at Euro 2008 in Austria and Switzerland.
STS was established in September 1983, and the 12 member states include Alabama, Arkansas, Florida, Georgia, Kentucky, Louisiana, Mississippi, North Carolina, South Carolina, Tennessee, Virginia, and West Virginia.
Under the Arabic abjad system, the letter Há has the numerical value of five , which is equal to the maximum number of days in Ayyam-i-Há.
2004 - Salient,Critic (2nd),Craccum (3rd)
Trinità dei Monti (think tank)
The undercarriage consisted of a single large pontoon below the fuselage and outrigger floats near the wingtips.
Manantico Creek
It was reported recently that Oculus VR (owned by Facebook) acquired Eye Tribe and all o f the employees andassets.
Rhiza
Chris Speyer may refer to:
List of minor planets: 513001–514000
In October, he had a one-month trial for the Premiership's side Leicester Tigers .
On April 7, 2014, Mayor Bill de Blasio appointed Tom Finkelpearl, former president a nd executive director of the Queens Museum, as the new DCLA Commissioner, "putting Mr. Finkelpearl in charge of a $156 million budget and making him the point person on the arts for a city widely conside red the cultural capital of the world."
The Hipster Handbook
"Thermarces cerberus" is found atgreat depthson the East Pacific Rise and the Galapagos Rift in the eas tern Pacific Ocean.
Samuel James Patter son
Marilyn Norry
In 1999, the Boalt Hall Women's Association created a fellowship in Kay's name to support students pursuing "public interest work benefiting women."
68 yea rs of its successful existence,theschool has made significant contribution towards educational excellence.
Ablaye Yare Faye (born April 10, 1994) is aSenegalese professiona l footballer who plays for PrimeiraLiga club Aves as a defensive midfielder.
2002 Limerick Senior Hurling Championship
Someof the local fruits arethe gamgyul,wh ich is grown in open fields; hallabong, created especially for Jeju, and cheonhaehyang, both grown in greenhouses; and unshu, grown in fieldsand greenhouses.
Du ring the planning of the Hanover–Hann.
He exhibited his pano rama in S an Francisco and other communities.
Detelj played in the USL PDL between 2009 and2012 with clubs such as Fort Wayne Fever, Westchester Flames and Long Island Roughr iders, before signing hisfirst professional contract with USL Pro club DaytonDutch Lions on August 15, 2014.
During the late 1960s, therewere plans for a r adio series starring Peter Cushing as the voice of D r. Who.
This region is distinguished for its cultural-historic mo nume nts:the Muselim'sPalace, a typical example of the Turkish architecture built in the thirteenth century, the Tower of the Nenadovic Family, built in 1813 by Duke Janko, the church of Valjevo originating from 1838 which is a rare example of monumental classicistic style building in Serbia.
Çayköy is a village in Alaplı District, Zonguldak Province, Turkey.
The nest is built amongstgrass.
That forced Ukrainian cargoes idle on the border.
Aspen Lake is a swampy lake in th e Souther n Cascade Range, just west of Klamath Falls, Oregon, United State s.
On the 27th, Burkard staked his first victory claim, which was unconfirmed.
The axial sculpture consists of (on the body whorl 10) low rounded ribs with wider interspaces, obsolete on the base and the incremental sculpture indicated by the rather distant sharp striae.
Fo untain of A rmés
After an adjustment of township-level administrative divisionsof Junshan District on 20 November 2015, Junsh an District has 1 su bdistrict and 4 towns under its jurisdiction, they are:
Zlatko Kovač (Zlatko Vitez), a small-town professor ofCroatian language,moves to Zagreb to a new job in a gymnasium.
"Paetus" translates as"squinty"or "nearsigh ted."
Pyrausta pilatealis
Some of his most memorable results came at his home track: the challenging, cob bled , street circuit at Bremgarten near Bern.
Ivan Semyonov (athlete)
Chris Horder
Tom coached his brothers Tim and Terry, who were both starting quar terbacks for Mason High School.
Tsutomu Takeb e
Oncopeltus sanguineolentus
The Hachita Valley lies in the northwest of the Chihuahuan Desert, with the southeast ofthe valley draining southeast into desert regions of northern Chihuahua.
It was released digitally, via online music storesuch as Amazon MP3, iTunes and eMusic, in 2008.
In 1902, the Edison El ectric Company bui lt a substati on on the site.
As a young man, he studied withseveral architects, including Frank Lloyd Wright.
Gaël Monfils was the defending champion, but chose not to participate this year.
Thisshow did not live up tothe station's expectations and was canceled 14 months later when the station changed formats again.
In th e 2011 Census, Thorhild County had a population of 3,417 living in 1,458 of its 1,807 total dw ellings, a -3.7% change from its 2006 adjusted population of 3,547.
They recordedasix-track extended play, " Salive One!", live-in-the-studio at AAV Studios on 2 November 1982.
In 1723 she was thrown out again after claims t hat her acceptance work was in fact the work of her former master Van Huysum.
Tamseale
The final was held at 19:15.
P-66, G-52; 11.
Joseph Allen (September 2, 1749 – September 2, 1827) was a member of the eleventhUnited States Cong ress from (1810–1811).
Thus the distribut ion decreases exponentially, which is more slowly than the normaldistribution.
TheNo .
Aeonium tabuliforme
Hargicourt, Aisne
Calabro ma yrefer to:
1485 in literature
As per the 2011 C ensus of India, Baruihuda had a total populatio n of 11,574 , of which 5,864 (51%) were males and 5,610 (49%) were females.
Robert Me glič
He was succeeded by Gordon Thorn e.
Maidenkirk ( sometimes Kirkmaiden; Scottish Gaelic: Cill M' Eudan) is a small settlement in Galloway, Scotland, located approximately so uth of Stranraer.
Following his senior year, Wright played in the 1974 East -W est Shrine Game and the 1974 Senior Bowl.
In October 2007, the Port of Wilmington became the first port to implement the Transportation Worker Identification Credential.
Journey (picture book)
Moorehead graduated Phi Beta Kappa from Vassar College, receiving The Sara Caitlin Award for Religio us Leadership andgraduated Cum laude with a Master of Divinity degree from Virginia Theol ogical Seminary, receiving the Harris Award for Academic Excellence and Leadership Ability.
Give Le e Give Lee Rock Lee
Duringa March 17, 2008 appearance on "The Oprah Winfrey Show", judge Simon Cowell chose Castro as one of his four favor ites in th e competition, along with David Cook, David Archuleta, and Brooke White.
Caberini
Her maternal aunt Ambika was al so a contemporary of Radha's, and Thulasi has reveale d she often seeks advice on acting from her mother, sister and aunt.
The Fire trade for Freddie Ljungberg (from Seattle) and also sign NeryCastillo from Shakhtar Donets k.
The l atter appeared as "Islamic History through Coins" [Cairo: AUC Press, 2006], which was the co-winner of the 2007 Samir-Shamma-Prize of the Royal Numismatic Society of Great Britain for the best book in Islamic numismatics d uring the preceding twoyears.
In this position, he co-founded in 1980 the International Federati on for Systems Research of which he became vice-presi dent and from 1986 to 1988 president.
His best known works are the carvings for the choirstalls of the Ulm Minster.
Apartfrom the town of Karczew,Gmina Karczew contains the villages and settlements of Brzezinka, Całowanie, Glinki, Janów, KępaNadbrzeska, Kosumce, Łukówiec, Nad brzeż, Ostrówek, Ostrówiec, Otwock Mały, Otwock Wielki, Piotrowice, Sobiekursk, Władysławów and Wygoda.
Applications
It consists of more than 100stars brighter than 14th magnitude in a 10 arc minute field, the brightest of which are blue supergiants of apparent magnitude 6.5 and 6.7.
Sook
There are holes of 1– 2 cm in the cheese, which is yellow with a darker rind.
Billington's films include "The Rise and Rise of Michael Rimmer" (1970), which stars Peter Cook, while his theatre work includes several productionsof play s by Harold Pinter, his brother-in -law.
He was a member of the Roughriders' fi rst Grey-Cup winning team of 1966.
Góra Blachowa is a vil lage in the administrative district of Gmina Wojsławice, within Chełm County, Lublin Voivodes hip, in eastern Poland.
Coka, Tibet
Zaptime
Flagel was the winner of the CFL's Most Outstanding Canadian Award in 1987 and was a CFLAll-Star three times.
Inmany states, independent contractors are not eligible for unem ployment benefitsbecause nothing has been paid int o the unemployment insurance fund on their behalf.
Immediately following his election, he was appointed ProvincialSolicitor and thus became a member ofthe Executive Council; he remainedon the Executive Council until 27November ofthat year.
Trept
Jack Carter (actor)
At the endof his life h e supported Theodore Roosevelt and the Bull Moose faction of the Republican party.
He hasgiven solo perfor mances with major orchestras such as the London Philharmonic Orchestra and Royal Philharmonic Orchestra.
The clubis a multi purpose sports club with its association football team having won the Curaç ao League First Division in the 1936–37 season.
It was created in 1 973, along with th e National University of San Juan, split off the National University of Cuyo based in Mendoza.
The most characteristic coastal formations of the predecessor ofthe pr esent Baltic Sea, the Baltic Ice Lake (11,200–10,600 years ago),which ma rks the one-time water level, are situatedon the north-western and western edges of the Sakala Upland.
Their name was changed from "The Centurions" to "The Centurians" sometimeafter 1967 due to legal reasons.
The following rivers are tributaries to the river Slănic :
Thissys tem was then inherited by Conrail andAmtrakand various commuter agencies running on former PRR territory such as SEPTA andNew Jersey Transit.
In 1658 Faithorne engraved a large map of London which had been drawn by the S omerset landowner Richard Newcourt.
Thiscan look very similar to an infection of the urinarysystem.
El Rincón
The album was recordedover several improvisational jam sessions,and was released in N ove mber 2012 under Lopatin 's Software Rec ords imprint to generally positive critical reviews.
Rakhshanda was born in British Burma to a Pashtun father and a Burmese mother.
Bradley A. Smith (born 1958)is the Josiah H. Blackmore II/Shirley M. Nault Professor at Capita l University Law School in Columbus, Ohio.
Nevertheless, in 1764, the Board of Ordnance granted the company a lucrative contract to supply arm amentsto the British armed forc es.
Nianzishan is located on the Yalu River, some tothe west of Qiqihar's main urban area.
He was originally taught to dra w and paint by his grandmother at around the age of seven.
After graduating, he made experimental films and exhibited his drawings in galleries inToronto.
Their songs, which went on to become Israeli classics, include "Einec h Yechola" (You Can't), "Kol HaShavua Lach" (The Whole Week for You), "Ahava Rishona"(First Love), "Yehezkel" (Ezekiel), "Chayal Shel Sho kolad" (Chocolate Soldier), "Kama Naim" (How Pleasant) and more.
The Zevenbergen railway station has, together with nearby Oudenbosch, oneof the oldest station buildingsstill existing in the Netherlands.
Onttola railway station
Oxford University Press commissioned the two to visit India and produce illustrations.
Aharon Kapitulnik
Agara, Georgia
Zarchi published his latest novel-screenplay "Death Wish Soozan", which is available on Amazon.com.
"Black Dwarf" is a re-recording with Lowe on vocals.
He began his architectural training in 1852 with Ch auncey Graham, a local builder-archi tect.
He was signed as a free agent by the San Francisco Giants on April 5, 1991.
World Cup qualific ation resumed later in the yearand despi te Australia sitting t hird in the group, an away win ag ainst Japan would have seen them qualif y for the World Cup witha game to spare, however they lost the fixture 2–0.
One of the duties of the"oidores" wasthe weekly inspection of the prisons, to investigate the con dition of the premises and to guarantee good treatment of the prisoners.
Within the Lublin Voivodeship the parkis: within Biłgoraj County in Gmina Aleksandrów, Gmina Józefów, GminaŁukowa, and Gmina Obsza; and within Tomaszów Lubelski County in Gmina Susiec.
Fiennes or ffiennes may refer to:
Influential organisers became not active before the end of the 1970s.
The following player received entry as a lucky loser:
It lies approximately north-east of Sierpc and north-west of Warsaw.
Carleton Rode
Her 1933 collab oration with Diedrich Hermann Westermann, "Practical Phonetics for Students of African languages", was reprinted many times.
She was voted intothe European Parliament in 2019.
The velocity of the ball at time t (0 ≤ t ≤ t0 ) is
This work was supported by NSERC (Canada), the DOE Contract No. DE-AC05-06OR23177, under which Jefferson Science Associates, LLC operates Jefferson Lab, and the Australian Research Council through an Australian Laureate Fellowship (A.W.T.), a Future Fellowship (R.D.Y.) and through the ARC Centre of Excellence for Particle Physics at the Terascale.
In virtue of the aforesaid, the experiments on registration of the group delay in the Bragg reflection waveguides were performed on the samples with locally thin (see below) Bragg mirror, which provided possibility of local coupling of light into the waveguide. In this case, we employed the phenomenon of anti-mirror reflection, specific for the waveguiding structures with leakage described in the next section.
φi : Xi → Yi
for some r > 0, and
Introduction
Background
Case 2. α is a limit ordinal. Define
Homogeneous nucleation in a supercoled gas of Lennard-Jones particles is obtained by MD simulations. The temperature of the nucleating cluster is for the first time obtained every time step, and the simulations reveal that it is always a small cold cluster which initiates the nucleation. The temperature in a nucleating cluster fluctuates, but the mean temperature of the cluster remains below the temperature in the supersaturated gas until the critical nucleus is created. The temperature of the nucleating cluster changes in a systematic way with the degree of supersaturation. For less supersaturation an even colder cluster starts the nucleation (Table 1,Table 2). The initial results are obtained for five moderate supersaturations at a temperature T = 0.80 between the triple- and critical temperature. We have, however, tested that the dynamics are valid for nucleation of liquid droplets at other temperatures (T = 0.70 and 0.90), but further work needs to be carried out to clarify e.g. whether it also is valid for more complex systems like nucleation of water droplets.
In the few GeV energy regime the excitation and decay of resonances dominate the hadronic cross section. Therefore, all interactions fall in one of 4 categories: elastic scatterings, inelastic scatterings, decays and resonance absorption. In order to conserve detailed balance only 1 ↔ 2 or 2 ↔ 2 processes are allowed.
In this situation of totality of mutual correlations it is natural to consider a prequantum grand field. Random fields corresponding to quantum systems are simply random signals generated by such a grand field. Hence, this work can be considered as a step towards classical unified field theory. However, this is a very preliminary step.
Schwarzschild spacetime
Topological field theory
Bias due to Inaccurate Sky Background Subtraction
Figures 12(a) and 13(a) demonstrate the spectra of π + - and π 0 -mesons produced in proton-nucleus collisions. The z-presentations of the same data are shown in Figures 12(b) and 13(b).
The paper is organized as follows:
Nanotubes may have very complex electric properties, but their atoms will be ionized rapidly in a strong electromagnetic field, so we assume that they have electric properties of plasma cylinders with complex permittivity
The structure of this paper is as follows.
In this section we give some examples comparing the different measures of exchangeability to each other and to the correlation coefficient, which is often used to quantify the relationship between two genes. We expect the exchangeability to highlight other relationships than the correlation coefficient since the latter does not take into account the specific experiment.
The Engineering software is used for test, maintenance and calibration. This package provides engineering software per each subsystem which can work only with the local system, and simulator for each connection and interaction point for simulating missing subsystems during development and maintenance.
On the other hand, it follows from the definition of conditional probability that
and conversely
With the preceding background to the scope and purpose of the present work we start from the AH model including superexchange for which the Hamiltonian can be written as
To finish the proof, we claim that there exists 0 < c < 1 such that
Without any loss of generality, we can write the scalar field in the form:
Dynamics of a lattice Universe. The dust approximation in cosmology.
For the purposes of the present paper, the multiplicativity condition will play as well a central role. We have the following result, clarifying the algebraic meaning of this condition, and making the link with the abstract considerations in section 2 above.
We observed V2275 Cyg beginning on HJD2452930.61 (2003 Oct 18) with the 1.8-m Vatican Advanced Technology Telescope (VATT). This was 790 days after maximum light. Observations continued the next night starting at HJD2452931.59. The CCD was binned 2×2 providing a scale of 0.4 arcsec/pixel. V -band exposures were 120 seconds with 30 second readout time covering about 10 hours over the two nights. The resulting images were bias subtracted and flat-fielded and instrumental magnitudes were measured using aperture photometry. Three comparison stars near the nova (Figure 1) were also measured and their positions listed in Table 1. Approximate V -band magnitudes for the stars were estimated from zero-point and airmass coefficients measured at the VATT on earlier runs with standard magnitude errors estimated to be ±0.05 mag.
7. Pellet injection in toroidal plasmas The complete interaction between a pellet and a plasma has not been throughly studied until now. Sato discussed our present knowledge about pellet injection. Fast density oscillations have been observed just after pellet injection. A long helical tail, which is independent of the magnetic field, has been observed.
Acknowledgments. We would like to thank D. Gourevitch, N. Honda and P. Polesello for their comments which helped us to improve the presentation of this work.
and, also before subtractions,
Entropy growth
Derivation from OPE
Ru (P ) × S → L(X)
Conclusions
This paper is concerned with entire solutions to the system
Keywords: Right loop, Normalized Right Transversal, Stability Relation, Center Congruence 2000 Mathematics subject classification: 20D60; 20N05
To get the covariant differential, we will focus on the evolvement
We use the notation in section two to state the main results in this article. Here some basic and special notations will be explained, which will be defined again in the next section.
Replacing H in the Hubble law vr = Hr we obtain the recessional velocity of a galaxy:
Possible Confirming Tests of the Hypothesis
and
We notice in this table, besides three further instances of non-affixal morphology, a majority of pairs involving circumfixation of one of the members.
The case of a constant Lorentz factor
Remark: Knowledge on the Tanner graph of a code C can be used in the selection of algorithms. For example, if it is known that the Tanner graph of C does not contain a certain subgraph Y , then all graphs containing Y must be removed from a trapping set profile.
Any B ∈ G is called a block of G.
Hence, the series
Introduction
The observation of the rotation of the plane of polarization as a function of wavelength in extragalactic radio sources has long been known to give unique information on the strength of cosmological magnetic fields (Kronberg 1994). This technique gives information out to redshift of about 2.5, and can in principle do this on the line of sight to a polarized radio source at any redshift.
Within the framework of SCHC, the two properly normalized amplitudes, written explicitly in terms of corresponding cross sections, are
Conclusions
and N times
In the second case we have
where a(r) is such that
2.- The time dependence of e(T) follows from a particular application of the equivalence principle for short intervals of time. It guarantees that at this level of approximation, as far as electromagnetism is concerned, the cosmological medium behaves as vacuum behaves in local physics.
A new tentative.
where αi (i = 1, 2) is the static polarizability of the i-th three-dimensional isotropic harmonic oscillator, that is
We now characterise the points of Σ∞ in relation to the C-lines.
The correct sequence of Γ events is the following.
Consideration of an elastic matrix : coupling with fibers of the fabric
3.2 Implementation
Non-penguin Radiative Decays
it will possess off-diagonal correlations given by
Since the standard 2-parametric Chaplygin gas model causes too much acceleration, we propose to combine it with the standard 2-parametric self-decelerating DGP model, taking the cross-over length scales to be proportional. The proportionality constant subsequently disappears because of a normalizing condition at z = 0. Thus the model has only one parameter more than the standard ΛCDM model.
Then
The body orientation order parameter
where the last estimate holds for l > a ≫ rg .
In Section 2, we briefly review some special numbers and polynomials, which are the Bernoulli numbers, the Euler numbers, the Stirling numbers, the central factorial numbers and the array polynomials.
MCW would like to thank the Department of Mathematics, Duke University, for their hospitality and gratefully acknowledges funding by the STFC (formerly PPARC), United Kingdom. AOP strongly acknowledges the research funding support of NSF Grants DMS- 0302812, AST-0434277, and AST-0433809.
Introduction
Chaplygin-Kalb-Ramond Quartessence
and
ΓEMe = 103 ± 0.2.
The next result is an important invariance property of global sections of descent problems.
with α < 1, and with
We recall the following definition
N =2 ⇒ N =1 ⇒ N =0
Polinseq testing constitutes a part of polinseq quality engineering.
Introduction
Next, we study the avalanche size distribution in which the avalanche size represents the number of nodes that fail successively. This distribution follows the power-law,
The Fourier transform of this nice function is given by
Our second result states as follows
The paper is organised as follows. In Sect. II we introduce the fundamental equations and the underlying physical framework of the gravitational lensing, mainly focusing on the SFL regime. In Sect. III, we briefly revisit the MGD as well as the CFM solutions, in order to fix the notation and to define the main setup that shall be further analysed. Sect. IV is devoted to the observable quantities in the SFL regime, containing our results and their analysis, for the solutions discussed in the Sect. III. To conclude, in Sect. V we summarise the results, point out our concluding remarks and perspectives, and discuss the possibility of detection/observation of signatures of the MGD and CFM solutions.
After SC we have a maximally entangled state across two positions. Tracing out the coin system we obtain the maximally mixed state across two positions,
LHCb detector status and commissioning
In the same approximation, the potential energy, including the torsion term, is
Thus isomorphism of the lattices does not guarantee TRO equivalence, even for multiplicity free nest algebras.
where λ = λ(m) is constant at m.
Deviation from the Mean-Field Exponent: Finite Size Scaling
The Langlands Program has emerged in recent years as a blueprint for a Grand Unified Theory of Mathematics. Conceived initially as a bridge between Number Theory and Automorphic Representations, it has now expanded into such areas as Geometry and Quantum Field Theory, weaving together seemingly unrelated disciplines into a web of tantalizing conjectures.
Once each of the calibration parameters is determined and the conversion from ADC counts to photoelectrons is well defined, the calibration with muon ring can be carried out.
5. Conclusions
Model field and equations
with, again, the primes restricted mod 8 as with f2 (α; N). Note R2 (n) is a weighted counting of the number of representations of n as a sum of two primes congruent to 3 or 5 modulo 8. Clearly if R2 (n) > 0 then there must be at least one representation of n having the desired properties. Further, from our choice of c1 we see every representation of n is counted if n is of size N + o(N); if n is much larger, we are only counting the representations with each prime factor at most c1 N and could therefore miss some.
Applying dissipative dynamical systems to pseudorandom number generation: Equidistribution property and statistical independence of bits at distances up to logarithm of mesh size
The fast Fourier transform
can be thought of as representing physical time, while the three real coordinates
PACS codes : 11.25.Sq, 11.25.-w, 11.15.Pg. Keywords : AdS, baryon, brane configuration, supersymmetry.
Set
Ghosh P., Lamb F.K., 1979, ApJ, 234, 296
Here we give a brief review on the space group selection rule for allowed Yukawa couplings in heterotic orbifold models. That will be useful to study the selection rule for allowed Yukawa couplings in intersecting D-brane models.
for r > 0 small, where ν is the outward normal unit vector to the sphere ∂Bn(xi , r).
Using equation (3)
with
or
and define
The following Lemma enables us to compute the geometric genus and irregularity of the quotient surfaces:
Then, eq.(4) for N = R2 × M reads
Homeomorphic Solutions to Reduced Beltrami Equations
The most recent gamma ray results come from the FERMI-LAT observatory (Mizuno et al., 2011). These workers have examined the local region of the Outer Galaxy: specifically the Local Arm and the Perseus Arm regions as well as the IA region between the two. For gamma ray energies of greater than 0.3 GeV they found similar intensities from the Perseus arm and the IA region, implying a deficit of around zero. They found 15% less emission from the IA region than that in the Local Arm, implying a deficit of 15%. Hence, these values indicate deficits due to IA, SA differences of less than or order 15%.
To conclude this letter we reduce ourselves to mentioning some aspects of our analysis that deserve a deeper understanding.
We start from the difference equation for P (x, t):
IRAC
Figure Captions
Acknowledgements
From the above proposition, we deduce that homogeneity and parallelizability are preserved under equivariant blowing up:
The amplitude is measured with respect to the baseline. Firstly, the average of 32 samples before the arrival of the pulse was used to estimate the baseline mean value, as well as the baseline RMS for each channel, defining the noise. The baseline mean value was subtracted from all samples, shifting the average baseline to zero. The amplitude is obtained as the maximum value of the signal.
A. L. Burin, I. Ya. Polishchuk,
Example 1
If no others are present within the repulsion zone individuals move towards those within an attraction zone ZA and seek to align themselves with their neighbours within an orientation zone ZO
while the others remain the same:
for all f, g ∈ D
The term on the r.h.s. has been called the turbulence creating term and its significance to turbulence theory has been investigated by Theodorsen (1952). Substituting the equation (19) derived by Thomson (1931) and rederived by Marmanis (1996), we have
Density functional theory calculations
Let M be a Nash manifold. We denote by
We let Dn,r denote the smallest positive integer such that Dn,r Xn,r (x) has rational integer coefficients.
and the linear operator
so that we can obtain both β, and of course α, from γ.
Diffraction methods are used to detect atomic order in solids. While uniquely ergodic systems with pure point diffraction have zero entropy, the relation between diffraction and entropy is not as straightforward in general. In particular, there exist families of homometric systems, which are systems sharing the same diffraction, with varying entropy. We summarise the present state of understanding by several characteristic examples.
Acknowledgements. We are grateful to Jonathan Barmak for many useful discussions and suggestions during the preparation of this article. We also would like to thank Volkmar Welker and Tim Porter for useful comments.
Properties of IM Peg and its Surroundings
Acknowledgments. It is a pleasure to thank Prof. dr. Renate Loll for many helpful discussions, and for insightful comments on the CDT measure. I would also like to thank Dr. Bianca Dittrich for useful conversations about quantization on a curved background.
Due to the shifted boundaries, we would refer to such a system simply as a compound memory electronic system (or a memtronic system in short). It is foreseeable that some complex nano-, organic or biological systems possessing electric memory have to be described in such a general manner.
1. Characterize the class of series-parallel graphs with boxicity ≤ 2.
vd × (O(λ7 ), O(λ6 ), O(λ2.5))
Improved model, problem of equivalent width
The spectral problem concerning this Hamiltonian turns out to be in a category to which one can apply the tools in solvable models.
Thus,
This immediately implies
Conclusion
yielding the same result. We note that in order to obtain equation (7) it is not necessary to assume any specific value for γ(r0 ). The latter quantity is model dependent, and therefore is arbitrarily defined.
Optimization problems whose solutions must satisfy several constraints are called restricted optimization problems. If all constraints as well as the objective function are linear, we call them linear programs, LP for short. The linearity of such problems suggests the following canonical formulation for arbitrary LP problems.
Further we have
do not admit a closed-form, but they do satisfy the three term recurrence
Acknowledgments
To study the thermodynamical variables of the distinguishable particle system, we consider two subsystems of particle number N1 , N2 , volumes V1 , V2 , energies E1 , E2 , respectively, in which their particles, volumes, and energies are allowed to be exchanged.
Matching to χPT and the Q-value
We model recurrent selective sweeps as a Poisson process with scaled rate ν. The probability that no sweep occurs for a time t (in scaled units of 2N generations) is then exponential:
In this report we showed our work about using joint deep learning architecture for car detection applications. The main idea of joint deep learning is to include feature extraction, part deformation handling, occlusion handling and classification in one single deep neural network where two layers of convolutional layers exist. The first layer extracts feature maps using low-level features that are tuned during the training phase. And the second convolutional layer is responsible for deformation handling to extract a score based on different visible parts of an object.
Currently, the HERA interaction regions are optimised for high luminosity running, with focussing magnets placed close to the interaction region. This sets a limit on the minimum measurable four-momentum transfer squared of about 4 GeV2 . These high luminosities are essential for the measurement of small spin-induced asymmetries and also for high statistics eD measurements. At low Q2 , event rates will be high and substantial upgrades of the front-end electronics may be required.
Superluminal Signal Velocity
To prove the assertion we start with a decomposition of unity
Quantum Sequential Growth Processes
We focus now on the results of diffraction theory. Due to the complexity of the present numerical calculations for growing fractals (8 hrs circa of CPU Convex time for each run), our results are based in a statistics of only few different clusters for each class of complex structures considered. The data shown next is displayed for illustrative purposes, whereas the straight lines (used to estimate df ) are the result of our crude, but representative, statistics.
We are now ready to prove the following result:
As the principal curvature spheres sα and principal curvatures καβ are defined on edges, not vertices, we lose the ability to look for points in the domain where sα is exactly perpendicular to p or q. Thus we reformulate the conditions for singularities and parabolic or flat points by finding vertices in the domain at which the καβ change sign in at least one direction:
Acknowledgements
is the electromagnetic potential,
Vσ = gσ, Vπ = gπ.
Course Structure
Two-step experiment assumes both measurement and comparison of the measured and calculated with the tested functions ρ = ψ(Eex ) and k = φ(Eγ ) emission probability of two correlated reaction products. There can be two gamma-quanta or particle and gamma-quantum. The function shape for probability distribution of their registration with the determined parameters in one- and two-step reactions is different. Just this difference causes different value of systematical uncertainties of measured nuclear parameters and high resulting reliability of their values in two-step reaction.
Now we are ready to prove the main asymptotic formula:
The results illustrate what occurs inside the memory as pulses are sent in. As the sent pulses are coupled in, the magnitude of the atomic coherence increases. As echo pulses are coupled out, the magnitude decreases. Decay due to other processes is apparent at other times. As the atomic coherence increases, the coupling in also increases due to the interference effect. This is apparent both as the larger increase in the atomic coherence at each coupling and as the decrease in the leakage of the sent pulse. Eventually, the other loss processes balance the increase, and equilibrium is reached.
For k > 1, we define
where we used that every Bloch function f satisfies
which it is proved to be useful to describe the one-dimensional variation of the field across the interface.
Obviously, we have
A planar proximity graph is a planar graph where two points are connected by an edge if they are close in some sense. A pair of points is assigned a certain neighbourhood, and points of the pair are connected by an edge if their neighbourhood is empty. Here we consider the most common proximity graph as follows.
PACS: 74.20.Fg, 74.25.Bt, 81.05.ue, 63.22.Rc Keywords: Graphene, Superconductivity, Thermodynamic properties.
implies that
Suppose that t(x, y) is a real or complex-valued function on the Cartesian product E × E. Thus we get a linear mapping T from the vector space of real or complex-valued functions on E to itself, as appropriate, given by
Our purpose is to find dynamical Yang-Baxter maps giving birth to Hopf algebroids and rigid tensor categories.
and so on. We can write these sums in terms of unrestricted sums:
Lower bounds on the number of auxiliary variables
Linear optical properties of the surface states
giving evidence for the conserved current
Let r2 (n) denote the number of representations of n as a sum of two squares. So we have
Neutron-Mirror-Neutron Oscillations in a Trap
In weak scattering limit
subject to the non-linear constitutive relation
Key words: gravitation - stars:oscillation - white dwarfs - stars:individual:G117-B15A
Numerical Error
From C(3) = 4/3 and C(8) = 3 we find
Then summing over a1 , a2 , a3 with the proper shifts of variable to get the same multinomial coefficient brings us to
Conclusions
The LAT team has taken several steps to minimize the latency in reporting events of multiwavelength interest:
Evaluation Index System
or in terms of preon processes:
where p̃0 = p0 + 2Gn sin2 θW . The solutions can be written in the form
At the resonance frequency, the matrix A reduces to:
We would like to stress that the general Lorentz force has also the SO(2) electro-magnetic duality symmetry.
Clearly CX is a one dimensional sphere S 1 but K and L are contractible.
Basically, the language designer using an LDA picks suitable language building blocks from the language knowledge base (language library), customizes them, and composes them into larger and larger language fragments. It may be necessary to add entirely new building blocks and concepts in the process, especially domain-specific ones, since it cannot be expected that everything required is already present in customizable form. The LDA provides feedback during customization and composition. Finally, the finished design is implemented by a language development system that serves as back-end to the LDA.
Hence
Exponential of a Matrix, a Nonlinear Problem and Quantum Gates
Acknowledgements
As can be seen, in this case there is still one chemical potential, corresponding to the BQ asymmetry. All the other charges can now be expressed in terms of BQ .
Conclusion and Open Problems
Velocity Transformations
where R is the radius of the shell, n0 is the number of particles at R = R0 and h the scale. The 3D expansion will be characterized by the following properties
Here
Using Wiener-Khinchin relation, for the spectral density of emitted radiation we obtain:
From the Rayleigh quotient and applying the above lemma to the Fielder vector, we have the following theorem concerning the algebraic connectivity.
where,
Current Response in Extended Systems as a Geometric Phase: Application to Variational Wavefunctions
Before proceeding, let us specify the frame work and the metric that we are going to use. The cosmological principle, i.e., the assumptions of homogeneity and isotropy of the Universe, implies that there should be no preferred point in the Universe. This is obtained when the spatial part of the metric has a constant curvature. The Robertson-Walker metric is the most general metric that merits these properties even if c0 is replaced by c(t), i.e.,
Note that all above equations have been written in the matrix form, in agreement with the discussion of the previous section.
While writing the paper the author was supported by the DFG grant for the Graduiertenkolleg Experimentelle und konstruktive Algebra at RWTH Aachen University (GRK 1632).
According to Dominated Convergence Theorem, for sufficiently large n,
Our universe
An inverse theorem for cofinite subsets
To conclude, we describe the behavior of metamolcule driven by the external field. It is shown that fluorescence at dissipation larger than driving is accompanied by narrowing of the spectral line by the order of magnitude and splitting of the Wigner function of the emitted light. This effect may find applications in quantum systems where strong noise due to high losses is unavoidable problem like in plasmonics.
Two corollaries result if A ⊆ U and B ⊆ V , or vice versa.
Other characteristics
Here we prove that
We introduce agreement ratio to measure to what extent two unidirectional models agree on phrase alignment:
In particular cases the construction of satellites is given.
The equation of state (EOS) of the target and projectile fluids is that of an ideal nucleon gas plus compression terms. We use a linear ansatz for the compression energy with a compressibility of 250 MeV and a binding energy of 16 MeV.
In the rational case we say that the potential
1 Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627, USA
We reach this result from the following steps:
Nico Stollenwerk (email: nks22@cus.cam.ac.uk)
whereby we have introduced a grading structure on the Hamiltonian through setting
Again by a direct computation we have
In this case by definition of the central extension we have that
Firstly, we can calculate the relative entropy of entanglement for this state exactly. A simple calculation yields:
Profile distribution model
Constraints and relevant degrees of freedom
G has a path from v to u.
We assume that system S and heat baths Bm are as a whole isolated and that they only come into contact with some external mechanical systems and the feedback controller. Apart from the feedback controller, the total Hamiltonian can be written as
({A, C}, B), ({A, D}, C), ({A, D}, B), ({B, D}, C), ({A, E}, C), ({A, E}, B), ({B, E}, C).
x ∈ W ⊆ K.
For an isolated PO with an odd number of bounces one has the following contribution :
Results
with K = K1 K2 .
but that exists a property P such that:
Anecdotal evidence and visual examination of some galaxies suggest that chaotic gas inflows often result in mis-alignments of newly formed stellar disks with previous stellar disk/non-spherical bulges, and the orbital planes of infalling satellite stellar or gas clumps do not always have a fixed orientation. These processes cumulatively may be thought to create stellar distributions in the central regions that are dynamically hot, which, in turn, provides conditions that are unfavorable to secular formation of stellar bars. We check if this indeed is the case.
and
π1 (U) = Γ ⊂ SU(2, 1).
For simplicity here we consider the case of simplest potential systems for systems of (1 + 1)-dimensional equations only. Note that all below statements and notions can be easily generalized to n-dimensional case and to general potential systems constructed using several conservation laws simultaneously.
on the boundary ∂G.
Our future work will apply probFuse to larger collections with greater levels of incompleteness in their available relevance judgments (e.g. the Web track collections of later TREC conferences). We intend to investigate whether the performance of probFuseJudged and probFuseAll diverges as the level of incompleteness increases. In addition, the relevance judgments for some collections differentiate between different degrees of relevance (e.g. for the WT10G collection, documents can be judged nonrelevant, relevant and highly relevant). We also intend to investigate whether adjustments to our probability calculations that take this information into account will be beneficial.
If ∂e u > 0 for some direction e, then u is a 1D function.
If the autocorrelation of the coding pattern is not bi-valued with a single central peak and flat wings, then ghosts of bright sources will occur in correlation images. They can in principle be avoided by noting that at each of the ND points in the detector one measures a linear combination of the contributions from each point in the sky (plus background). Provided the problem is not under determined, the inverse of the matrix representing this coding can be used to obtain the sky distribution which led to the observed data.
Xiaochun Luo
Comparing Models
HF acknowledges partial support by the Deutsche Forschungsgemeinschaft under Grant No. Fr 737/2 and AK acknowledges with thanks the Fellowship Grant from the Alexander von Humboldt Foundation.
When I was a young man, my thesis adviser was Nathan Rosen, and the subject was the existence of gravitational radiation in general relativity. Only much later, I seriously learnt quantum mechanics, and still much later information theory. I now want to return to my roots and try to combine all these subjects together.
The identity representation (id) does not produce any change in the signal when projected. So we only use these one dimensional irreducible representations to match the dimension of the representation matrix with that of the signal. For example, the representation matrix for rotation is given by the ith irreducible representation (ri ) as
with
Note that this criterion is statistical rather than logical. We emphasize that after the observations were carried out we only accept or reject the appropriate hypothesis.
The results show that for small errors in the coefficients the estimated variance of b1 and b2 is also small and the estimate is realistic. The first case was computed without artificial noise, in this case the accuracy seems to be determined mainly by the statistics program. Adding noise deteriorates the accuracy of the results rapidly. While a relative error of 0.0001 (case 2) still leads to a reasonable result, the tenfold relative error (case 3) already means that the calculated uncertainty of b2 is about 7%. A one- percent inaccuracy in the data (case 4) gives a result even with the first digit uncertain. As case 5 where the number of data- points is raised to 2001 shows, increasing the size of the data-set may at least partially compensate for noise.
where Nc is the color factor of the Feynman diagram and FS its symmetry factor. We note that within this approximation there is no interference effect between the gauge and contact amplitudes.
which can be solved for r and subsequently obtaining α0 and s. The drawback is that r and s are required to be integers, so we cannot arbitrarily choose m, n and ρ. To give an idea of the situation we present some tables, assuming for simplicity that both m and n are integers. It follows that also α0 has to be an integer. Because we want a negative correlation and because α0 ≥ 0 we have the restriction
The possibility that accretion disks play a role in PNe formation was first suggested by Morris (1987). More recently Soker & Livio (1994) and Reyes-Ruiz & Lopez (these proceedings) have explored the formation of disks in binary PNe systems in more detail. In these works there has been a tacit assumption that disk = outflows. Obviously there is gap in the theory and it remains unclear if or how accretion disks in PNe can create collimated outflows that match observations. I now review two classes of disk wind models that may be applicable for PNe.
Within our collaboration work is now ongoing to improve the existing models and to combine different approaches in order to provide detailed predictions for direct comparison with the rich observational dataset.
Here we discuss the high-temperature behavior of the contributions of branches (i), (ii), and (iii) to the total thermal energy density ρL of propagating longitudinal modes. Moreover, we discuss the role of branch (i), which dominates ρL , in potentially providing magnetic seed fields for MHD dynamos upon the breaking of spatial isotropy and homogeneity by astrophysically and large-scale structured matter.
Summary and Conclusions
This research was supported by the Israel Science Foundation, grant no. 1082/13. The Tesla K40c used for this research was donated by the NVIDIA Corporation.
For easy future reference, we introduce the following conditions:
We have studied the effects of DM self-interactions in collisions of galaxy clusters with particular focus on the resulting separation between the DM halo of the sub-cluster and the collisionless galaxies. In our analysis we have made the distinction between frequent collisions with small momentum transfer and rare collisions with large momentum transfer. Only when the fraction of expulsive collisions f is much smaller than unity, is it possible to have frequent DM self-interactions without violating observational constraints on the evaporation rate. When this is the case, DM self-interactions can be described by an effective drag force. However when f is large, DM self-interactions must be rare and an effective description of collective effects is not possible since only some fraction of the DM particles are affected at all. Overall we find significant differences between these two classes of DM self-interactions concerning both qualitative and quantitative predictions. It is therefore important to make a clear distinction between them.
The Virgo Project, http://www.virgo.infn.it/
This results in the following claim to prove our lower bound:
By assuming that very dense matter is made of weakly interacting quarks, one could try to understand the thermodynamic properties of the corresponding ground state by first completely neglecting the interaction between quarks. In order to construct the ground state, it is important to keep in mind that quarks are fermions, i.e., particles with a half-integer spin, s = 1/2. They should obey the Pauli exclusion principle which prohibits for two identical fermions to occupy the same quantum state.
Conversely, we want to observe that for any module V, satisfying any of the conditions (a)-(d), the graph G(V ) does not contain K4 .
We now need to specify a functional form for the various transfer components. Let us consider a system containing N scalar fields, with a Lagrangian
Computational Study of Evolutionary Selection Pressure on Rainbow Trout Estrogen Receptors
We have
So far we have not taken into account the physical effects of the ln z cut in the currents. At first sight, the presence of ln z in the currents appears to be contrary to the periodicity requirement of closed strings. However, this is not true. The periodicity requirement arises as a boundary condition in the process of minimizing the action. In other words only on mass shell physical string configurations are required to be periodic. In the presence of the extra zero mode the Hilbert space is larger. One must require periodicity in the physical on shell sector. The physical sector is identified as the subspace of states for which the matrix elements of the currents are periodic.
We now mimic the approach of M14 to constrain the amount of unbound hydrogen material in SN 2014J by both direct comparison with NIR spectra of other SNe Ia at similar epochs and by implanting Paβ emission features into our data.
A derivation of two quadratic transformations contiguous to that of Gauss via a differential equation approach
where fπ ≃ 93 MeV, and the vector meson couplings are defined as
Compass has stayed true to its core mission of increasing diversity and improving the academic experience of its participants. It has created a strong, supportive community of undergraduate and graduate students who are empowered to shape the organization to meet their needs. Compass also provides opportunities for its participants to develop important scientific and leadership skills that are often absent from the undergraduate or graduate experience.
Introduction
where xi denotes the position of particle i. Using the sawtooth representation one can show that for the Fermi sea that the spread in position
while all other coordinates remain fixed. In detail this is done as follows: We partition the phase space into different channels. Within one channel, the phase space is generated iteratively according to
The description of the experimental angular distributions by DWBA is acceptable but significantly poorer than for proton transfer. Furthermore, the prior - post equivalence is not well established (especially for deep OM potentials) pointing at the limits of accuracy of the DWBA approach for alpha particle transfer in the 7 Li+7 Li system.
is strongly positive in M4k (A).
Line ratios as Te and ne indicators
It is useful to define the quantity bQG (R) as the ratio of the amplitude of the quasar/galaxy cross-correlation function ξQG (R) to that of the galaxy auto-correlation function ξGG (R):
In the case j = 0, it is known that Φs (3) is prime for s = 7, 13, 71, 103, 541, 1091, 1367, 1627, 4177, 9011, 9551, 36913, 43063, 49681, 57917, 483611, and 877843. It seems plausible that there are infinitely many such values of s but this remains to be proved.
We will need the following even moments of X and Y :
Most detectors are not sensitive to the spin state of the incident particles. The results corresponding to this particular situation can be obtained directly from our expressions. For incident identical particles the dependence of the two-particle detection on the modulus of the wavefunction is in the fourth power, just as in the example of the previous Section.
We have shown that by using an Autoencoder to initialise the temporal weights of a TRBM, forming what we call a TARBM, a significant performance increase can be achieved in modelling and generating from a sequential motion capture dataset. We also show that the TARBM is able to learn high level structure from natural movies and account for the transformation of these features over time. Additionally, the evolution of the learned temporal filters are easily interpretable and help to better understand how the model represents the trained data.
We assume the PDC light is collected into two single-mode fibers using identical lenses (with focal lengths f ) both placed at a distances d from the fiber tips and M d from the crystal face, where M is the magnification. (We assume that the fibers define single Gaussian modes. See Fig. 1 for a schematic of this setup.) In this situation we can write the biphoton field as
In terms of the other parameters,
One has
Definitions
In this paper we establish the FP for the two rich clusters Abell 665 and Abell 2218. We use the data for these two clusters together with earlier published data for CL0024+16 (van Dokkum & Franx 1996) and data for the Coma cluster to study how the M/L ratios of the E and S0 galaxies change with redshift.
As said above, our encoding/decoding schemes rely on local entanglement preparation and measurements for every code with intersection points of logical operators situated on adjacent vertices of the lattice, which is the case of the Haah code.
and let
i.e., (F, G) is a WZ pair and by Proposition 1, we get
Acknowledgments
where Π represents:
Although one could consider this situation in the frames of the hydrodynamic nulear model, it does not appear when we study the real neutron stars. Therefore, except for the main transition region, the solution is determined by equation
So it follows that
Introduction
The clustering coefficient C of HDRAN can be obtained as the mean value of C(k) with respect to the degree distribution P (k) expressed by Eq. (7). The result is
The main equations
Computational considerations
The second ingredient involves bounds on moments of the integrator that are uniform in the time-step size. These bounds enabled the local error estimates to be extended to global error estimates, and hence, pathwise convergence on finite time-intervals. These bounds are automatic if initial conditions are restricted to the known equilibrium distribution the Metropolis-adjusted integrator is designed to sample. To relax this restriction on initial conditions, geometric ergodicity played a key role to obtain such bounds. MALA is often ergodic, but because its proposal chain is often transient, is not geometrically ergodic. This transience is due to a numerical instability in forward Euler for large energy values. By suitably truncating the drift at high energy values, one can ensure the proposal dynamics is not transient. MALA with truncated drift, or MALTA is known to often be geometrically ergodic on infinite time-intervals where MALA is not. The paper used this property to prove MALTA is pathwise convergent on finite time-intervals without a restriction on its initial condition. We remark that MALTA can be generalized to explicit higher-order, multistep and adaptive integrators for overdamped and inertial Langevin equations.
as before. On the other hand, the solution for u < 0 is
New York Times Results
The above modeling work is based on a scene recognition task using 10 categories. In real life, however, there are a much larger number of scene categories. Beyond scenes, general object recognition and face recognition are the two most important recognition tasks that are performed regularly. The relative importance of central versus peripheral vision among the three categories needs to be examined carefully. Using a similar modeling approach, we describe our findings in large-scale scene, object, and face recognition in the sections below.
For any x > 0, we note that
2 Dipartimento di Fisica and INFN, 40126 Bologna, Italy
Thus free energy of the system becomes
Letting n → +∞, one gets :
y = p2 ,
Thus the total Lagrangian density is
NA44 Collaboration:
It is interesting to remark that the semigroup λ(X) contains many non-principal maximal linked systems that commute with all ultrafilters.
I thank A.F. Andreev, V.I. Marchenko, A.S. Rybalko, and A.I. Smirnov for fruitful discussions. This work was supported in parts by RF president program NSh-4889.2012.2 and RFBR grants 13-02-00912 and 13-02-90494.
By construction it is centered at a point ai,k associated to a tile Ci . Let us assume that the radius ri,j is a priori bounded by the distance between f k (5/4.Ci ) and the complement of f k (3/2.Ci ). Since ai,k ∈ 5/4.Ci , the ball Bi,k is contained in 3/2.Ci and can only intersect the cubes 3/2.C such that C and Ci are adjacent tiles. If Bi,k intersects Bj,k , the point aj,k+1 is thus associated to a tile adjacent to Ci .
This work is funded by NSF under the grants CCF-0963726, CCF-0830245.
There was also an example of a hyperbolic embedding of the de Sitter space whose interval can be written under the form
and
where
Isometries and Construction of Permutation Arrays
A well-known single sum
Discussion and Future Work
In addition to the equations of motion, these terms must also vanish at each end of the string. That is,
E(W (Tn )) = (ω + o(1))n5/2
GEOMETRY OF DE SITTER SPACE
The 1.740-MeV 0+ ; 1 level
Introduction
Now, we have
Proof. Consider the weight function
In the following two lemmas, we give some useful properties about the same axes sets of two Kleinian groups.
We also give a random value for ξ since it depends on the string coupling gs whose value is set by complex structure moduli stabilization. We use the explicit formula of ξ:
Thus b1 = 4 and g can be represented as follows
Acknowledgments
The paper is organized as follows. In sect.2 we calculate the cross-section for A0 production. We present our numerical results and give a discussion about them in sect.3.
This suggests that the fluxtube cutting mechanism is competitive as an r-mode saturation mechanism, being at least as efficient as mode-coupling. This result supports our earlier claim that a more detailed investigation of the physics of fluxtube-vortex interaction as a source of friction for the r-mode instability is needed.
Our estimates for the lower bounds are
Introduction
Let ξij , 1 ≤ i, j ≤ n be independent random variables. Assume that there is a constant ρ < 1 (not depending on n) such that for all 1 ≤ i < j ≤ n, ξij has the ρ-property. Observe that we do not require ξij be identical, and that furthermore we do not place any requirements on the diagonal elements of the matrix.
where 1 ≤ j ≤ n + 1.
We are now ready to extend some of the well-known characterizations for normal programs to normal constraint programs. The key is the notion of a dependency graph for normal constraint programs.
which again has plane wave solutions with a modified frequency. Hence, the solutions during the two phases can be written as follows:
Let B be the proper transform of the pencil M on the threefold U. Then
Generating 1-form
Example
Integrating by parts results in
LAB16 has the two photo-z selected objects within the Lyα halo. #2 is newly detected.
F := OX (KX + E).
from which we deduce
and obtain
Now we recognize that
Inner limit
Finally, we recall the notion of isomorphism for ALPVs.
while the classical turning point of motion is given by
can be estimated directly, where Mm is the total number of configurations {α}. This is the main advantage of using PERM. For any observable Am , the mean value is therefore,
In the next section we briefly introduce our effective Lagrangian. In the following section we present results of our analysis. In Conclusions we summarize our findings and outline the prospective steps of this investigation.
Again, the Inclusion-Exclusion Principle shows that
In this proceedings, we will determine whether the nuclear accretion rate is declining as a function of time in step with the decline in the SFR between z=1 and the present, and whether the SMBHs within red galaxies are accreting a significant proportion of their mass in this time.
Thus we have:
Statistical Analysis
where σS and σA are the symmetric and antisymmetric cross sections. These are expressed in terms of the forward and backward cross sections σF and σB as follows:
The second lemma is about the measure of the level set of G:
Thus,
We also note a false positive (a pedestrian being detected as anomaly) in the last image of column (b). Upon further investigation, this false positive was due to the fact that the cells in the region of the pedestrian had minimal or no activity during the training phase. Consequently any foreground object entering this zone during testing was considered as anomalous, irrespective of the observed features.
Department of Physics, Columbia University, New York, NY 10027
We refer to such functions λ(t) as admissible shape functions and investigate the Cauchy problem
so that
Multiply the two primes, producing a large number.
s(γ , r) ≥ sκ (r)
For some runs, we use hyperviscosity and hyperdiffusivity for the dissipation terms. The power of hyperviscosity is set to either 2 or 8, so that the dissipation term in the above equation is replaced with
Then we have
From the second point above, using standard definitions, and displaying explicitly the scalar product used for symmetric-hyperbolicity it is clear that our work is correct, furthermore the calculations in the work we are commenting are the same than those we have previously done.
Department of Physics and Astronomy
The Hydra Consortium exists to provide public domain software and data for N-body, hydrodynamical simulations.
Notice that Nasdaq during the 1985 - 2000 years did not fall off more than 6 weeks in raw in the weekly quotes and more than 4 month in raw in the monthly quotes. Last time Nasdaq was down 4 months in raw in the period September 2000 - December 2000. Using the results of Table 5, one could predict with certainty (with unit probability) a positive move of Nasdaq for January 2001. Such a prediction would be the correct one.
Keywords: Quantum Information Processing, Quantum Computing, Special Linear Lie Algebra, Cartan Subalgebras.
This definition is too simple to fully capture the notion of continuous spectrum, but it will be adequate for our purposes.
It can be shown that these three schemes are in agreement with S̃(Γ) = 0 and thus with the gauge independence of tan β. Furthermore, they define tan β in a universal way, using only quantities of the MSSM Higgs sector.
Thus, the number of inequivalent observable sector embeddings satisfying the CMM conditions is presumably six; we take CMM observable sector embeddings 1, 2, 4, 6, 8 and 9 as representatives of these six. This does not mean that only six models of this type exist. For each choice of the six inequivalent {VA , a1A , a3A } there will be many possible hidden sector embeddings {VB , a1B , a3B }, not all of which are equivalent. CMM have left the hidden sector embedding unspecified and the purpose of this paper is to enumerate the allowed ways (up to equivalences) of embedding the hidden sector.
Distributed implementation of standard oracle operators
{f (e) : e ∈ D, e < d1 , f (e) < f (d1 )}
The following is our main theorem.
Denote
Conclusions
In preview of the paper layout, we begin by introducing the reaction-diffusion equations that we will use as the drive system. We discuss how this system is solved numerically and the parameters used to simulate complex spatiotemporal dynamics. Next, we implement the response system and show the parameter PDEs used to find autosynchronization. We demonstrate the power of the systems of PDEs to autosynchronize by employing three different spatial functions for the parameters. Next, we show the estimated parameters and the convergence plots for both state variables and parameters to the correct values. Finally, we give an improvement on the response system that admits autosynchronization wherein only one species is sampled, which is an important breakthrough for applications since generally only the phytoplankton is easily observable.
are sufficient for the commutativity but they do not determine completely the coefficients. Thus several solutions can be found, and one should further check that the operator constructed is independent of H and N.
Now we are in position to prove the following result.
The important item for future R and D works is fabrication of (1) intense lasers with high quality to obtain large excited atom density n for SPAN, and (2) realizing heavy ion circulation with high coherence ρeg for its RENP. In both cases a high coherence, either at the macroscopic level or at the single ion level, is of crucial importance for further developments.
Given the wealth of data in live chat systems, this research proposes a novel data mining approach to evaluate customer experience from unstructured chat dialogs. We explored the opportunity to mind the minds of customers based on a set of features about sessions and sentiments. By analyzing unstructured chat content, we can extract the possible feedbacks buried in chat logs and determine (1) what topics are being discussed in chat logs, (2) what sentiments those chats accompany, and (3) what the overall satisfaction level of customers is.
and an alternative mass-ratio distribution where both components are chosen randomly and independently from the same IMF (Set 3).
Conclusions
Nunc est bibendum,
Higher Peclet number case
and
Involutions on matrix algebras and bilinear forms
where
It also yields a solid foundation for the comparison of different EAs or different heuristic paradigms. This includes the question in how far design choices affect performance such as the choice of representations, operators, and parameters. In some cases running time analyses allow to draw conclusions about optimal parameter settings. Some of the above questions can be answered. Last but not least, theoretical analyses lead to insight into the working principles of EAs and to a better understanding of their behavior.
Acknowledgements
Here Φ denotes the original SM Higgs doublet. The scalar potential obeys a Z2 symmetry. We allow S to acquire vacuum expectation value and express the Higgs fields in unitary gauge as
(ii) Every infinite set endowed with the cofinite topology is (hereditarily) sg-compact.
The Lorentzian metric interpretation discussed above implies a geometric analogy between coherent Lagrangian vortex boundaries and photon spheres in cosmology. Below we give more detail on this analogy, followed by an improved version of its summary with a more relevant reference.
PHOTON DETECTORS
We have shown how restricted quasi-Kronecker matrices can be block rotated and factorised, and how this enables efficient inference in the two-level functional additive model. A similar closed-form factorisation for generic quasi-Kronecker matrices eludes us despite repeated attempts. That would certainly make an interesting topic for future work although perhaps not our own.
4 Nagoya University, Nagoya 464, Japan.
while the constraints are
Tunka-Rex is a digital radio array for the detection of air showers in Siberia. Besides determining the precision and overall benefit of a radio detector in combination with an air-Cherenkov detector, its goal is to determine the absolute scale of radio emission. Therefore, we performed an absolute calibration with a commercially available reference source, reaching an accuracy for an individual amplitude measurement of 22%, including 18% uncertainty on the absolute scale. The same reference source was also used by LOPES and LOFAR. These three experiments now have a consistent amplitude calibration. Comparing the measured amplitudes to the predictions of the simulation code CoREAS, we find agreement within the uncertainties. Therefore, Tunka-Rex confirms the applicability of CoREAS for the simulation of absolute amplitudes of radio emission by air showers. It also provides a measure of the absolute scale of radio amplitudes in its frequency band.
Another important effect, particularly for the low frequency instruments, is that of direction dependent gains. In most radio telescopes, the gain of the antenna is largely a function of the direction angles relative to the pointing direction. This is described by the pattern of the primary beam, A(l, m), where l and m are direction cosines relative to the pointing direction. However, there is also some dependence on the absolute pointing direction of the telescope relative to the ground, making the pattern of the primary beam a function of the zenith angle, Z, and parallactic angle, χ, as well. For electronically steered low frequency telescopes such as the MWA, highly accurate compensation for this effect is a key issue.
Results
S. ZAPPERI1 , P. RAY2 , H.E. STANLEY1 AND A. VESPIGNANI3
Status
As a prelude to what might be expected as forthcoming breakthroughs in finding new approaches toward solving three-dimensional lattice models in the twenty-first century, we review the exact solutions of two lattice models in three dimensions obtained using the conventional combinatorial and transfer matrix approaches.
(WeakH): Whenever λ is a cardinal such that there is no graph homomorphism c : G → Kλ then Kλ is a minor of G.
see, for ex., Gallager, 1968.
where
Because the WIMP will, in most cases, only scatter elastically, one also sees that parity and time-reversal selection rules that operate for diagonal matrix elements will limit what can be learned in direct detection experiments.
Pendulum Integration and Elliptic Functions
Radial structure of galactic stellar disks
In this paper we generalize this result to normal varieties with mild singularities:
Coordinate Transform
(iii)⇒(iv) This is obvious.
So far, the few proper motion measurements available for LG dwarf galaxies seem to indicate that the latter have low eccentricity orbits (e.g. the Magellanic Clouds in Kroupa & Bastian 1997 and Sculptor in Schweitzer et al. 1995). If this result will be confirmed by the forthcoming generation of high-precision astrometric missions, like GAIA and SIM, the outer flattening observed in the stellar profiles of dSphs will be hardly explained within CDM models. Recently, Eke et al. (2000) have shown that in warm dark matter models small galaxy halos have NFW profiles with c < 5; these cosmologies would easily match the observations and, in addition, could yield the correct number of satellites in galaxy halos (Moore et al. 1999) as well as halo profiles soft enough to reproduce the rotation curves of LSB galaxies (de Blok et al. 2000).
It is convenient to change integration variables in dxs = dφd(sin α) from (φ, sin(α)) to (sin(βq )), sin(α)). We thus get
Examples
Hence,
Distortion Measurements
Nevertheless, the metallicity data give values somewhat higher than what might be naively expected from the Local Group hypothesis. Furthermore, all but one of the HVCs that have been measured are in the southern hemisphere where there may be some confusion with MS gas; the interpretation of the origin of the metallicities is therefore not unambiguous one way or the other as Gibson (this volume) points out. As is true for the Hα test, it would be useful to have some of the small, high negative velocity clouds near M31 measured, but finding suitable background sources is difficult.
Scintillation Counters
If one wished to show directly that the sphere was merely increasingly trapped, the corresponding expression would be
We wish to find q L (x, t) and q R (x, t) satisfying
Accounting for turbulent scalings
This work was supported, in part, by Science Foundation Ireland grant 09/IN.1/I2637 and by NSF grant 1522954-IIS. Any opinions, findings, and conclusions or recommendations expressed in this material are those of the authors and do not necessarily reflect the views of the sponsors.
On a construction of A. Lucchini
Discussion
Temperature
for all k ≥ 1.
Deep reflectance codes give us a compact representation that encodes the reflectance disks which we expect to encode rich information about the physical properties of the material itself. We are particularly interested in probing tactile properties of a surface from its reflectance appearance. For this, we focus on estimating friction from reflectance disks. In this section, we introduce the first-of-its-kind friction-reflectance database and then apply deep reflectance codes to estimate friction from one-shot in-field reflectance disks.
where
A common problem in computational physics is computing the eigenpairs of large matrices. We will present a new Monte Carlo algorithm that allows the simultaneous determination of a few extremal eigenpairs of a very large matrix without the need to orthogonalize pairs of vectors to each other or store all the components of any vector.
We chose to compare against the uRNN architecture because it set state of the art results in terms of both data complexity and accuracy and because it is an architecture with similar design objectives as low-rank passthrough architectures, namely a low-dimensional parametrization and the mitigation of the vanishing gradient problem, but it is based on quite different principles (it does not use a state passthrough as defined in this work, instead it relies on the reversibility and norm-preservation properties of unitary matrices in order preserve state information between time steps, and uses a multiplicative unitary decomposition in order to achieve low-dimensional parametrization).
In addition several important results have been discussed:
and
In order to compute the sum
O. Savin was supported by NSF grant DMS-1200701.
In this work we take seriously the last possibility, and investigate the idea of introducing a modified MPP to predict the SM Higgs boson mass from the requirement that our vacuum has only barely survived early cosmology (call it metastability MPP). We shall ask if there should be reasons that MPP ideas might after all lead to metastability MPP. Further we shall ask, phenomenologically, whether such a metastability MPP fits the data.
A great deal of observational firepower will be directed at the problem of star formation in the coming years, but we already know one essential fact: star formation is a collective process. Most stars (perhaps nearly 100% in our Galaxy) form in clusters. There are strong interactions with the surrounding environment and among protostars. Quantifying feedback processes, both positive and negative, is a key to understanding star formation. All this means that star formation is a more difficult problem than was the astrophysics of isolated stars. Progress will be importantly informed by observations of other galaxies and a wider range of environments than are found in our Galaxy.
Notice also that
Therefore,
Inferring Internet AS Relationships Based on BGP Routing Policies
The first term in such expansion is linear in x, that account boundary condition on the plate (isothermic one). The coefficient, noted as C(y) satisfy an ordinary differential equation of the fourth order. It means that we need four boundary condition in y variable. The differential links of other coefficients with C add two constants of integrations hence a necessity of two extra conditions. These conditions are derived from conservation laws in integral form.
In the last step we used that for prime p
Civil vs religious marriage in Italy, 2000-2006
Let Y l (e) be the set of <l -intervals J l satisfying:
Introduction
Conclusion
with
Along the same lines, we get
Critical KS sets are sets of IDs as described above. Again, the IDs in a KS set need not be critical in the sense given for IDs, but instead the KS will be called critical if no subset of IDs and/or qubits can be removed from the set such that a smaller KS set remains. These critical KS sets are then the minimal structures in the N -qubit Pauli group that demonstrate quantum contextuality.
The authors thank Professor Matts Roos and the organizing committee of the NEUTRINO 96 Conference for the possibility to present the results of this work there.
We have created an interactive tool which allows observers from all around the world to plan their observations with a concrete scientific goal (enhance the Gaia Solar system science), coordinate with other observers in observational campaigns, and feel the excitement of being part of a real space mission such as Gaia. We encourage all the observers to register for free at the GOSA site (www.gaiagosa.eu) and spread the word to other astronomy fans.
Appendix B: Carrier Capture
where the pressure (P ) is given by an equation of state,
V. V. Sagun, A. I. Ivanytskyi, D. R. Oliinychenko, K. A. Bugaev
And, if observing a single but resolved source, the Visibility function will be a decreasing function with baseline length and the rate of decrease will be inversely proportional to the angular size of the source. For a source with a Gaussian brightness profile, for example, the Visibility function will also decrease with a Gaussian profile, and the half-maximum width of the Visibility function will be inversely proportional to the half-maximum width of the source brightness distribution.
Hour-Scale Multiwavelength Variability in Markarian 421
Let us consider in the Hilbert space H the formal expression describing the interaction model
Simulation Results
Y CVn: The pulsation period is uncertain, but is most likely 160 days.
the behavior of this function is presented in Figure 1 and the limits it reaches are the following:
and hence,
Massless final emitter, massive final spectator
To be Published in the proceedings of the 10th Marcel Grossman Meeting (World Scientific Co., Singapore), Ed. R. Ruffini et al.
(8) From Eq.(4A.19), we obtain
We also perform equivalent estimates for the curl signal in these fields. These estimates show negligible signal, indicating that the curl estimate is not a useful check for Poisson foregrounds.
Boundary conditions
Since
The Tree of shapes
Spectroscopy
Observe that
we have
In effect, the randomization test replaces the unknown tail probability p∞ with a biased estimator (b + 1)/(m + 1), the amount of positive bias being just enough to allow for the uncertainty of estimation and to produce a test with the correct size. This p-value calculation is presented in a number of textbooks on randomization tests including Davison and Hinkley (1997), Manly (1997) and Edgington and Onghena (2007).
Therefore, we have that
This research is supported by the Natural Sciences and Engineering Research Council of Canada.
Generally, we can expect two competing rates. First is the characteristic root elongation rate, directed downwards and second is the evapotranspiration rate directed upwards. The latter can be divided into the transpiration and evaporation components. It is clear that the root elongation rate would ultimately depend on the evaporation conditions as water serves as a major limiting factor in its growth. At low humidity conditions, we expect the evapotranspiration rate to be faster, thus the development of the evaporation front, zsup also occurs fast. When this happens, the evaporating front, zsup , eventually catches up with the root tip and quickly exposes a large portion of the total root system to a dry zone. The appearance of the dry zone certainly decreases water absorption rates.
Consensus Connectomes
Lensing refers to the magnification and/or appearance of multiple images of the cosmic-ray source due to uncorrelated deflections in the magnetic field. It roughly corresponds to the transition between the two realms mentioned above. This is an attractive possibility for using the observed angular distribution to infer greater details about the intervening magnetic field. For distant sources, the lensing effects are strongest near the critical energy,
Since G(c, y) has degree r in the variable c, we have |Xy | ≤ r. This gives a bound:
Using Soft Computer Techniques on Smart Devices for Monitoring Chronic Diseases: the CHRONIOUS case
Context-free languages and inverse star
SAMPLES
g1. The output Nof f of a fusion reaction (counting rate) is proportional to the deuterium concentration CD in the cluster (D2 O)N (the D atoms concentration in the target is constant).
is self-adjoint with eigenvalues rα , and Eα is the projection to the eigenspace of A with eigenvalue rα .
Introduction
The following γ-hadron selection cuts have been used: candidate events are accepted as γ-rays if MSCW < 0.3, MSCL < 0.45, and Θ2 < 0.015 deg2 . (To increase the number of γ-like proton events a much wider direction cut for proton events of Θ2 < 1 deg2 is applied in the following. All results are then scaled to the opening angle of Θ2 < 0.015 deg2 .).
It is interesting to note that regulation policies for the lowest and the higher layers are closer to each other than the middle ones. Policies to regulate the poorest layer will also contribute positively in regulating the upper ones. The middle layers follow a different dynamics on its own mostly due to the fact that they receive and send family units from both sides of the distribution.
Analysis of neural responses
Its explicit expression is
Sound Absorption and Dispersion in Dilute Polyatomic Gases: A Generalized Kinetic Approach
Let
Several new groups joined the search for, as well as the follow-up of the microlensing events. Their Web sites are:
Similarly, the geodesic equation implies
Motivation and Objectives
Estimation of memory parameters